KEGG   Rattus norvegicus (rat): 54234Help
Entry
54234             CDS       T01003                                 

Gene name
Cacna1e, CACHA1E, Cav2.3
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54234 (Cacna1e)
   04020 Calcium signaling pathway
    54234 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    54234 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    54234 (Cacna1e)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   54234 (Cacna1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 54234
NCBI-ProteinID: NP_062167
RGD: 2246
Ensembl: ENSRNOG00000002863
UniProt: Q923K6
LinkDB All DBs
Structure
PDB: 

Position
13q21
AA seq 2295 aa AA seqDB search
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRATMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFYW
IVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVLYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERERRRRHHMSVWEQRTSQLRRHMQMSSQEALNK
EEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLPLGLGLEKCEEERISRGGSLKGD
IGGLTSVLDNQRSPLSLGKREPPWLPRSCHGNCDPTQQETGGGETVVTFEDRARHRQSQR
RSRHRRVRTEGKESASASRSRSASQERSLDEGVSIDGEKEHEPQSSHRSKEPTIHEEERT
QDLRRTNSLMVPRGSGLVGALDEAETPLVQPQPELEVGKDAALTEQEAEGSSEQALLADV
QLDVGRGISQSEPDLSCMTTNMDKATTESTSVTVAIPDVDPLVDSTVVNISNKTDGEASP
LKEAETKEEEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTNPIRKACHYIVNLRYFEMC
ILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYF
RDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAV
FDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEK
NKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRME
MSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTR
YMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPWTYELALKYLNIAFT
MVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLELF
RAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEES
HINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNESERCGTDL
AYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGR
IHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALD
IKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYY
KQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIISNAKALPYLQQDPVSGLSGRSGYPSM
SPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQSSNHGIYLPPDTQEHAGSGRA
SSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSL
RLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQ
SRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQLPPVPPKPRPLLSYSSLMRH
TGGISPPPDGSEGGSPLASQALESNSACLTESSNSLHPQQGQHPSPQHYISEPYLALHED
SHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRLGGLGLAMMCG
AVSDLLSDTEEDDKC
NT seq 6888 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcagaccaggctcaggcgatggagactcg
gaccagagcaggaaccgacaaggaacccccgtaccggcctcggggccggcggccgcctac
aagcagtcaaaagcgcagagggcgactatggctttgtacaaccccataccagtccggcag
aactgtttcacggtcaacagatccctgttcatcttcggagaagataacattgtcaggaaa
tatgccaagaaactcatcgattggccgccatttgagtacatgatcctggccaccatcatt
gccaactgcatcgtcttggccctggagcagcatcttcctgaggatgacaagaccccaatg
tcccgaagactggagaagacagaaccatattttattggaatcttctgctttgaagctggg
atcaaaatcgtggctctaggattcatcttccataagggttcgtacctccgtaacggctgg
aatgtcatggacttcattgtggtcctcagtggcatcctggccactgcaggaacccatttc
aacacccacgtggacctgcggaccctccgggctgtgcgtgtcctgaggcccttaaagctc
gtgtcaggaatacctagcctgcagatcgtgctgaagtccatcatgaaggccatggtgcct
cttctgcagattggccttctgctcttctttgccattctcatgtttgccatcattggcttg
gagttctacagtggcaagttgcatcgagcatgcttcatgaacaattcaggtattctagag
ggatttgatcctcctcacccgtgtggtgtacagggctgcccggctggttatgaatgtaag
gactggatcggccccaatgacgggatcacccagtttgacaacatcctttttgctgtgctg
actgtcttccaatgcatcactatggaagggtggaccactgtgctgtacaataccaatgat
gccttaggagccacctggaactggctgtacttcatccccctcatcatcatcggatccttc
tttgttctcaaccttgtcctgggcgtgctttccggggaatttgccaaagaaagagagaga
gtggagaaccgaagagcattcatgaagctccggcgtcagcaacagattgagcgcgagttg
aatggctaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaataaa
aactcgggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccggacg
gaggccatgacccgagactccagcgatgagcactgcgttgatatctcttcagtgggcaca
cctcttgccagagccagtatcaagagcacaaaagtagacggagcctcctatttccggcac
aaggaacggcttctgcgtatctctatccgacacatggtcaagtcgcaagtgttctactgg
atcgtcctgagtgttgtggctctcaatactgcctgtgtggccatcgttcatcacaaccag
ccacagtggctcactcacctcctctactatgcagaatttttgtttctgggactcttcctg
ttggagatgtccctgaagatgtatggcatggggccacgcctttattttcactcatccttc
aactgctttgattttggggtcacagtgggcagcatctttgaggtcgtttgggcaatcttc
cgacctggcacatcttttggaatcagtgtcttacgagctctccggctcctaaggatattt
aaaataaccaagtattgggcatccctccggaatctggttgtttccttgatgagctccatg
aagtctatcatcagcttactcttcctcctcttcctcttcattgttgtctttgctctcctg
ggaatgcagctctttggaggcaggtttaactttaatgatgggactccttcggctaatttt
gataccttccctgcagctatcatgacagtgttccagatcctgacgggggaagactggaat
gaagtgctgtataacggcatccgctcccagggtggggtgagctcaggcatgtggtctgcc
atctacttcattgtgctcaccttgtttggaaactacacactgctgaatgtattcttggct
atcgctgtggacaatctcgccaatgcccaggaactgaccaaggatgagcaggaggaagaa
gaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccgatgtctgct
cccaacatgccttccattgagagggagaggagacgccgacaccacatgtctgtgtgggaa
cagcgcaccagccagctgaggaggcacatgcaaatgtctagccaagaagccctcaacaaa
gaggaggccccaccaatgaaccccctcaatccactcaacccactgagtcctctcaaccca
ctcaatgctcatcctagcctctatcggaggcccaggcccattgagggcctacccctgggc
ttgggtcttgaaaaatgtgaagaggagcgtatcagccgtggaggttctctcaagggggac
ataggtggcctgactagcgtcctggacaaccagaggagccctttgtccctgggcaaacgg
gagccaccgtggctgcccagatcctgtcatggaaactgtgacccaacccagcaggagact
gggggaggagagactgtggtgacttttgaggaccgggccaggcacaggcagagtcagagg
cgaagccggcatcgccgagtcaggactgagggcaaggagtctgcctctgcctccagaagc
aggtctgccagccaggagcggagtctggatgaaggggtgtccatcgatggggagaaggaa
cacgagcctcagagcagccacaggagcaaggagccaaccatccatgaagaagagagaact
caggacttaaggaggaccaacagtctgatggtccccaggggctcaggactggtaggagct
cttgatgaggcagaaacacctctagtccagccccaacctgagctggaagtggggaaggat
gcagctctgacagagcaggaggctgaaggcagcagcgagcaagccctgcttgcggatgta
cagctggatgtgggccggggcattagccagagtgaacctgacctctcctgcatgacaacc
aacatggacaaggctaccactgagagcaccagtgtcacagtcgccatccctgacgtggac
cccttggtggactcaacagtggtgaacattagcaacaagacggatggagaagccagtccc
ttgaaggaagcagagaccaaagaggaagaggaagaggtggaaaagaagaagcagaagaag
gagaagcgggagactggaaaagccatggtgccccatagctctatgttcatcttcagcacc
actaacccgatccgcaaggcttgccactacattgtgaatctacgctactttgagatgtgc
attctcttggtgattgcggccagcagcattgccctggcagctgaggaccctgtactaact
aactcagagcgtaacaaagtcctgagatatttcgactatgttttcacaggagtgtttacc
tttgagatggtgataaagatgatagaccaaggcttgatcctgcaggatggatcgtacttc
cgagacctctggaatatcctggactttgtggtagtggttggtgcattggtagcatttgct
ctggcgaacgctttgggaaccaacaaggggcgggatatcaagacgatcaagtctctgagg
gtacttcgagttctgcgaccactgaaaaccatcaagcgcttgcccaaactgaaggctgtg
tttgactgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaagctc
tttatgttcatctttgccgtcattgctgttcagttattcaagggaaagttcttttattgc
accgacagttccaaggacacagagaaggaatgcataggcaactatgtagaccacgagaaa
aacaagatggaggtgaagggccgggagtggaagcgtcatgaattccactatgacaacatc
atctgggccctgctgaccctcttcaccgtctccacgggggaaggatggcctcaggttctg
cagcactcggtagatgtgacagaggaggacagaggcccaagccgcagcaaccgcatggag
atgtccatcttctatgtggtctactttgtggtcttccctttcttctttgtcaatatcttc
gtggccctcattatcatcaccttccaggagcaaggggacaagatgatggaggagtgtagc
ctagaaaagaatgagcgggcatgcatcgacttcgccattagtgccaaacctctcacccgc
tacatgccacagaacaggcacaccttccagtaccgcgtgtggcacttcgtagtctcgcca
tcctttgagtataccatcatggccatgattgccttgaacaccgttgtgctgatgatgaag
tactattctgctccttggacctatgagctcgccctaaagtacctgaacatcgccttcact
atggtgttttccctagaatgtgtcctaaaggtcatcgctttcggcttcttgaactatttc
cgagatacctggaacatctttgacttcattaccgtgatcggcagtatcacagaaattatc
ctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctggagctcttc
cgagctgcacggctcataaagcttctgcgacagggctacaccatccgcatcttactgtgg
accttcgtgcagtcctttaaggctctcccctatgtctgccttctgattgccatgcttttc
ttcatctacgctatcattgggatgcaggtgtttggaaacataaagttagatgaggagagt
catatcaaccggcacaacaactttcggagtttcttcgggtctctcatgctgcttttcagg
agcgccacaggggaggcttggcaggagattatgttgtcatgtctgggcgagaagggctgt
gagcctgacaccactgcaccctcagggcagaacgagagtgagcgctgtggcactgacctg
gcctacgtttattttgtctccttcatcttcttctgctccttcctgatgctcaacctgttt
gtggctgttatcatggacaactttgagtacctgactcgagattcgtccatcctggggcct
caccacttggatgaatttgtccgtgtctgggcagagtatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggc
aagagatgtccctccaaagtggcctataagaggttggtcctgatgaatatgccagtggct
gaggacatgacagtccatttcacctccacacttatggctctgatccggacagctctggac
attaaaatcgccaaaggtggtgcagacagacagcagctagactcagagctacaaaaagag
accctggccatttggcctcacctgtcccaaaagatgttggatctgctagtgcccatgccc
aaagcctctgacctgactgtgggcaagatctatgcagcaatgatgattatggactactat
aaacagagtaaggtaaagaaacagagacagcagctggaagaacagaaaaatgcacccatg
ttccagcgcatggagccctcctcactgcctcaggagatcatttctaatgccaaagccctg
ccttatctccagcaggaccctgtttctggcctgagtggtcggagtggatacccttcaatg
agtccactctcccctcaagaaatattccagttggcttgtatggacccagcggatgatgga
caattccaggaacagcaatcgctggagccagaggttagtgaattaaaaagtgtgcagtcc
tctaaccatggcatctaccttcctccggacacccaggagcatgcgggatctgggagggca
tcctctatgccacgtctgactatggatccccaggtggtaacagaccctagctctatgcga
cgttcattttctacaattcgggataagcgttcaaattcctcctggttggaggagttctcc
atggaacgtagcagtgaaaacacctacaagtcacgacgcagaagttaccattcctccctg
aggctgtcagcccaccgcctgaattctgactctggtcacaagtctgacactcaccgctca
ggaggcagggagagaggccgatccaaagaacgaaagcatctcctctctccggatgtctcc
cgctgcaattctgaggagcgaggaacccaggctgactgggagtccccagaacgtcgccag
tccaggtcacccagtgagggaaggtcacaaacccccaacagacagggtacaggttcactg
agtgagagctccattccctctatctccgacaccagcaccccaagacgaagtcgtcgccag
ctcccacctgtgccaccaaagcctcggcccctcctctcctacagctccctgatgagacac
actggcggcatctctccacctcctgatggaagtgagggtggatccccactggcctctcaa
gctctggaaagcaacagcgcttgcctaaccgagtcttccaactccttgcacccccagcag
ggccagcacccttccccacagcactacatctctgagccctatctggccctccatgaagac
tcccacgcctcagactgtggcgaggaggagacactcacctttgaggcagctgtagctact
agcttgggccggtccaataccattggctctgccccacccctacggcacagctggcagatg
cctaatgggcactatcggcggcggaggctggggggcctgggcctggccatgatgtgtgga
gctgtcagtgacctcctgagtgacacggaagaagacgataagtgctag

DBGET integrated database retrieval system