KEGG   Rattus norvegicus (rat): 54299
Entry
54299             CDS       T01003                                 

Gene name
Ncor1, Rxrip13
Definition
(RefSeq) nuclear receptor co-repressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04919  Thyroid hormone signaling pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    54299 (Ncor1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    54299 (Ncor1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    54299 (Ncor1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    54299 (Ncor1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     54299 (Ncor1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding
Other DBs
NCBI-GeneID: 54299
NCBI-ProteinID: NP_001258032
RGD: 3612
Ensembl: ENSRNOG00000055246
UniProt: A0A0G2K2B4
LinkDB
Position
10q23
AA seq 2414 aa
MSSSGYPPNQGAFSTEQSRYPSQSVQYTFPSTRHQQEFAVPDYRSSHIEVSQASQLLQQQ
QQQQQLRRRPSLLSEFHPGSDRPQERRTGYEQFHSGPSPVDHDSLESKRPRLEPVSDAHF
QRVSAAVLPLVHTLPEGLRASADAKKDSAFGGKHEAPSSPLAGQPCGDDQNASPSKLSKE
ELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQII
YDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHA
RKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERF
QRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFIN
MNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYY
LTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKMEKKEEEKKDDEEKD
EKEESKETTKEKDRTEATAEETEEREQVTPRGRKTANSQGRRKGRITRSMTSEAAAASAA
AAATEEPPPPLPPPPEPVSTEPVETSRWTEEEMEVAKKGNIQQCIIYNSASRKPREERDV
SQCESVASTVSAQEDEDIEASNEEENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSEN
AASRGNTEPVAELEATTDPAPCASPSSAVPTTKPAESESVEAQVTDSASVETAEPMDVDH
EECGAQGSSVLDPPAPTKADSVDPEIQVPENTASKGEGDAKDRDLESASEKTEARDEDLV
VAEQMQRPEPQSDNDSSATCSADEDVDGEPERQRVFPMDAKPSLLNPPGSILISSPIKPN
PLDLPQLQHRAAVIPPMVSCTPCNIPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQI
DLECRSSTSPCGTSKSPNREWEVLQPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTT
VASEKPSFIMGGSISQGTPGTYLTSHSQAYTPEAAKPSVGSISLGLPRQQESTKSAPLTY
IKQEEFSPRSQNSQPEGLLVRAQHEGVVRGTAGAVQEGSITRGTPASKISVESISSLRGS
ITQGTPALPQAGIPTEALVKGPVSRMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDN
IKNAREGTRSPRTAHEMSLKRSYESVEGNVKQGMSMRESPVSAAPLEERTVLSGSIMQGT
PRATAESFEDGLKYPKQIKRESPPSRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDIL
TQESRKTPEVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEI
VPENIKVVERGKYEDVKAGEPVRPRHTSVVSSGPSVLRSTLHEAPKAQLSPGIYDDSSAR
RTPVSYQNTISRGSPMMNRTSDGSSSKTTSHERKSALTPTQRESVPAKSPVPAVDSVVSH
SPFDPHHRSTTAGEVYRSHLPTHLDPAMPFHRALDPAAAYLFQRQLSPTPGYPSQYQLYA
MENTRQTILNDYITSQQMQVNLRPDVARGLSPREQPLGLPYPATRGIIDLTNMPPTILVP
HAGGTSTPPMDRITYIPGTQITFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERE
RERERERERERERERERERERERERITAAPTDLYLRPGSEQPGRPGSHGYVRSPSPSVRT
QETMLQQRPSVFQGTNGTSVITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAA
LVDAAASAPQMDVSKTKESKHEAARLEDNVRSRSAAVSEQQQLEQKNLEVEKRSVQCVCT
SSALPSGKPQPHASVVYSEAGKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIAS
DKDARERGSQSSDSSSSLSSHRYEAPSDAIEVISPASSPAPPQEKPQAYQPEMVKANQAE
NESPQQYEGPLHHYRSQQGSPSPQQQPPLPPSSQAEGMGQVPRTHRLITLADHICQIITQ
DFARNQVPSQPSTSTFQTSPSALSSTPVRTKPSSRYSPESQSQTVLHPRPGPRVSPENLV
DKSRGSRPGKSPERSHIPSEPYEPISPPQGPAVHEKQDSMLLLSQRGMDPAEQRSDSRSP
GSISYLPSFFTKLESTSPMVKSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSG
AVSSRSHSFADPASNLGLEDIIRKALMGSFDDKVEDHGVVMPHPVGVVPGSASTSVVTSS
ETRRDEGDPSPHSGVCKPKLINKSNSRKSKSPIPGQNYLGTERPSSVSSVHSEGDYHRQT
PGWAWEDRPSSTGSTQFPYNPLTIRMLSSTPPTPIACAPSAITQAAPHQQSRIWEREPAP
LLSAQYETLSDSDD
NT seq 7245 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttaccctcccaaccaaggagctttcagcacagagcaaagtcgttat
ccttcacagtctgtccagtatacctttcccagtacccggcaccagcaggaatttgcagtt
cctgactatcgctcttctcacatcgaagttagtcaggcatcgcagctcttacagcagcag
cagcagcagcagcagcttcgaaggcgaccttccttgctttcagaatttcacccaggttct
gacaggcctcaagagagaagaactggatatgaacagtttcactcaggaccctcaccagtg
gatcatgattccttggagtccaagcgtccacgcctggagccagtttctgatgcccatttc
cagcgtgttagtgctgcggttttacctttagttcacacgctgccagaggggttgagggcg
tctgcagatgctaagaaggattcggcatttggaggcaaacatgaagctccatcctctcca
ttggctgggcaaccatgtggagatgatcaaaacgcttcaccttcaaagctctcaaaggaa
gagttaatacagagtatggaccgggtagacagagagattgcaaaagtagagcagcagatc
cttaaattgaaaaagaaacaacaacagctagaagaagaagcagctaagcctcctgagccg
gagaagcctgtgtcccctcctcctgtggaacagaaacaccgtagtattgtccaaattatt
tatgatgagaatcggaaaaaagctgaagaagctcataaaatatttgaaggtcttggccca
aaagttgaattgccactctataaccagccgtcagataccaaggtgtaccatgagaacatc
aagacaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgca
agaaaacaaagggaacaaaaaatctgccagcgttatgatcaactcatggaggcatgggag
aaaaaagtggacagaatagaaaataatcctcggaggaaagcaaaagaaagcaaaacaagg
gaatactatgagaagcagtttccagaaattcgaaaacaaagagaacaacaagaaagattt
cagcgagttggtcagaggggagctggtctttcagccaccattgctaggagtgagcatgag
atttccgaaattattgatggcctttctgagcaggagaataatgagaaacaaatgcggcag
ctttctgtgattcccccgatgatgtttgatgcagaacaaagaagggtcaagttcatcaat
atgaatgggctcatggaggatccaatgaaggtttataaagacagacagtttatgaatgtt
tggactgaccacgaaaaggagatctttaaggacaagtttatccagcacccaaaaaacttt
ggactaattgcatcctatttggaaaggaagagcgtgcctgattgtgttttatattactat
ttaaccaagaaaaacgagaattataaagcccttgtgagaagaaattatgggaaacgcaga
ggcagaaatcagcagattgcccgtccctcacaagaagaaaaagtagaagaaaaagaagag
gataaagcagaaaaaatggagaaaaaggaagaagaaaagaaggatgatgaagaaaaagat
gagaaggaagagtctaaagaaacaaccaaggaaaaggatagaacagaagccacagcagaa
gaaactgaggagagagagcaggtcactccaagggggcgaaagactgctaacagccaaggg
cgtcggaagggccggatcaccaggtccatgacaagtgaagctgcagctgccagtgctgct
gctgcagccactgaggagccccctccaccgctgccaccacccccagagcccgtttctaca
gaaccagttgagacttcaagatggacggaagaagaaatggaagttgctaaaaaaggtaat
atacagcaatgtataatatacaacagtgcttcacgaaaaccccgtgaggaacgagatgtg
tctcagtgtgaaagtgttgcttccactgtgtctgcccaggaggatgaagatattgaagcc
tcgaatgaggaggagaatccagaagatagtgaaggtgctgaaaatagttctgatacagaa
agtgctccctctccttcaccagttgaagctgccaagtccagtgaagacagcagtgaaaat
gctgcttctcgaggaaacaccgaacctgtggctgagcttgaggccaccactgaccctgca
ccctgtgcatctccctcttcagcagttccaaccacaaaaccagcagaaagtgaaagcgtg
gaggcccaggtgactgacagcgccagtgtggagaccgcagagccgatggatgtagaccat
gaggagtgcggtgcccaaggcagttctgttcttgatccaccagcccctaccaaagctgac
tccgtggacccagaaatacaggtaccagaaaacactgcatctaaaggtgaaggggatgcc
aaggacagagacttggagagcgccagtgagaagacagaggctagagatgaagacttggta
gtggctgagcagatgcagaggcctgaaccacagtcagacaacgactccagtgccacatgc
agtgcagacgaggatgtcgatggagagccagagaggcagagagtgtttcccatggatgca
aagccttcactgttaaatcctccaggatcaatactaatctcatcccccattaaaccaaac
ccattggatctgccacagcttcagcatcgagctgctgttattccaccaatggtttcttgc
accccatgtaatataccaattggaacacctgtaagtggctatgctctttaccaacggcac
attaaggccatgcatgagtcagcactcctggaggaacagcggcagaggcaagaacagata
gacttggagtgcagaagttctacaagcccgtgtggcacttctaagagtccaaacagggaa
tgggaagtcctccaacctgctccacatcaagtgataactaaccttcctgaaggggttcgg
cttccaacaacacgaccaaccaggccaccacctcccctcatcccatcgtccaaaaccaca
gtagcatcagaaaaaccatcctttataatgggagggtccatctcacagggaactcctggc
acttacttgacttctcatagtcaggcttatactccggaagcagctaagccctcagtgggg
tctatctctcttggattgccacggcagcaggaatctaccaagtcagctcctttgacctac
atcaagcaggaagaattttctccacgaagccaaaactcacagcctgagggtttattggtg
agagcgcagcatgaaggtgtggtcagaggcactgcaggggctgtccaagaaggaagtata
actcggggaactccagccagcaagatctcagtggagagcatttcatccttgcggggctct
attacccaggggaccccagctctgccccaggctggcataccaacagaggctttggtgaag
ggacctgtttccaggatgccaattgaggaaagcagtcctgagaaggtcagagaggaagct
gcatccaaaggccatgtcatctatgaaggcaaaagtggacatatcttatcatatgacaat
attaagaatgcccgagaagggactcggagtccaagaacagctcatgaaatgagtttaaaa
agaagctatgagtcagtggaaggaaatgtaaagcaaggcatgtcgatgagggagtctcct
gtgtcagcagcacctttagaggaaaggactgtgctgtctggttccataatgcagggcaca
cctagagcaacagccgaaagctttgaagatggccttaaataccccaaacagataaaaagg
gaaagccctcctagtcgagcatttgaaggtgccattaccaaaggaaaaccatacgatggc
atcaccaccatcaaagaaatggggcgttccattcatgaaattccaagacaagatattcta
actcaggaaagccggaaaactccagaagtggtccagagcacgaggccaataattgagggt
tccatttcccagggcacaccaataaaatttgacaacaactcaggtcaatcagctatcaaa
cacaatgtgaagtccttaatcacagggcctagcaaactaccccgaggaatgctggaaatt
gtaccagaaaacataaaagtagtagaacggggaaaatatgaggacgtgaaagcaggcgaa
ccagtgcgaccccggcacacgtcagtggtgagctctggcccctccgttctcaggtctaca
cttcatgaagctcccaaagcacagttgagcccgggaatctatgatgacagcagtgctcgc
aggactcctgtgagttaccagaacaccatatccagaggctcccccatgatgaacagaact
tctgatggttcttccagcaagactaccagccacgagaggaagtcagctctgaccccaacc
caaagagaaagtgtcccagccaagtctccagtgcctgccgtggactccgtcgtgagtcac
agtccatttgacccccatcataggagtaccactgcaggagaggtttatcggagccatctt
cccacgcacttggatccagccatgccctttcacagggctttggatcctgctgctgcttac
ctgtttcagagacagctttcaccaaccccaggatacccaagtcagtaccagctttatgca
atggagaatacaagacagacaatcctaaatgattacattacctcacagcagatgcaagtg
aatttgcgccctgatgttgccaggggactgtccccacgagagcagccactgggtctccct
tatccagctacaagaggaatcattgacctgaccaatatgcctccaacaatcttagtgcct
catgcaggggggacaagcacccctcccatggacagaatcacttatatccctggtacacag
attactttccctccgaggccatacaatgctgcttctttgtctccaggacacccgacacac
cttgcagcagctgcaagtgctgagagagaacgagagcgggaaagggagaaggagcgagag
agagagcgtgagcgcgagcgcgaacgtgaacgcgaacgcgaacgtgaacgcgaacgcgag
cgtgagcgtgaaaggatcactgctgctcccactgacctctacctacgaccaggttcagaa
cagccaggccgccctggtagccacggatatgttcgctccccttccccttcagtaagaact
caggagaccatgttgcaacagagacccagtgttttccagggaaccaatggaaccagtgtg
atcacgcctttggatccaactgctcagctacgaatcatgccactgccttctgggggccct
tccataagtcaaggcctgccagcctcccgttacaacactgctgcggatgccctggctgct
cttgtggacgctgcagcttctgcaccccagatggatgtttccaaaacaaaagagagtaag
catgaagctgccaggttagaagacaatgtgagaagcaggtcagcagcagttagtgagcag
cagcagctagagcagaaaaacctggaggtggagaagagatctgttcagtgtgtgtgcacc
tcttcagcccttccaagtggcaagccccagcctcatgcctccgtagtgtattctgaggct
gggaaagataaagggcctcctccaaaatccagatatgaggaagagctaaggacccgaggg
aagactaccattactgcagctaacttcatagacgtgatcatcacccggcaaattgcctcg
gacaaggatgcaagggaacgtggctctcaaagttcagactcttctagtagcttgtcttct
cacaggtatgaagcacctagtgatgctattgaggtgataagtcctgccagctcacctgca
ccaccccaggaaaaaccacaggcctatcagccagagatggttaaggcaaatcaagcagaa
aatgagtcccctcaacagtatgaaggaccactgcatcattatcggtcccagcagggatca
ccgtctccacagcaacagccaccactgcccccatcgtcccaggcagagggaatgggacag
gtgcccaggacccatcgactgatcacacttgctgaccacatctgtcaaattatcacacaa
gattttgctagaaatcaagttccctcgcagccttctacttctacattccaaacttcacca
tctgctttgtcgtccacacctgtaagaactaaaccgtcaagtcgctacagcccagagtct
cagtctcagactgtcttgcatcccagaccaggtcctagagtctctccagaaaatcttgtg
gataaatcccggggaagcaggcctggaaaatccccagagaggagtcacatcccatcggag
ccctatgagcccatctccccaccccaaggtcctgctgtgcatgagaagcaggacagcatg
ctgctcttgtcacaaaggggaatggatcctgccgagcaaaggagtgattctcgatcacca
ggaagtataagctacttgccttcattcttcaccaagcttgaaagcacatcacccatggtt
aaatcaaagaagcaggaaatttttcgtaagttgaactcctctggtggaggtgactctgat
atggcagctgctcagccaggaacagagatcttcaatctgccagcagttactacatcaggt
gcagtaagctcaagaagccattcttttgctgatcctgccagtaatcttggtctagaagac
atcatcagaaaagctctcatgggaagtttcgatgacaaagttgaagatcatggtgttgtc
atgcctcatcctgtgggagttgtccctggtagtgctagcacctcagttgtgacgagcagt
gagacacggagagatgaaggggacccatcacctcattcaggagtgtgcaaaccaaagctg
atcaacaaatcgaacagcaggaagtctaaatctcctattcctgggcagaactacttagga
actgaaaggccttcttctgtctcctctgtacattcagagggtgattaccacaggcagaca
ccaggatgggcttgggaagacaggccgtcttcaacaggctccactcagttcccttacaac
cctctgaccatccggatgctgagcagtaccccgccaaccccgatcgcctgtgccccgtca
gccatcacccaggcagctccgcatcaacagagccgcatctgggagcgggagccggccccg
ctcctctcagcacagtatgagacactgtctgacagtgacgactga

DBGET integrated database retrieval system