KEGG   Rattus norvegicus (rat): 57298Help
Entry
57298             CDS       T01003                                 

Gene name
Gstm3, GstYb4, Gstm4
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno00980  Metabolism of xenobiotics by cytochrome P450
rno00982  Drug metabolism - cytochrome P450
rno00983  Drug metabolism - other enzymes
rno01524  Platinum drug resistance
rno05200  Pathways in cancer
rno05204  Chemical carcinogenesis
rno05225  Hepatocellular carcinoma
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    57298 (Gstm3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    57298 (Gstm3)
   00982 Drug metabolism - cytochrome P450
    57298 (Gstm3)
   00983 Drug metabolism - other enzymes
    57298 (Gstm3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    57298 (Gstm3)
   05204 Chemical carcinogenesis
    57298 (Gstm3)
   05225 Hepatocellular carcinoma
    57298 (Gstm3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    57298 (Gstm3)
  Drug resistance
   01524 Platinum drug resistance
    57298 (Gstm3)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     57298 (Gstm3)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   57298 (Gstm3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_3 WD40_alt
Motif
Other DBs
NCBI-GeneID: 57298
NCBI-ProteinID: NP_065415
RGD: 620381
Ensembl: ENSRNOG00000019058
UniProt: Q9WU21
LinkDB All DBs
Position
2q34
AA seq 218 aa AA seqDB search
MAMILGYWNVRGLTHPIRLLLEYTDSNYEEKRYVMGDAPNFDRSQWLSEKFNLGLDIPNL
PYLIDGSHKVTQSNAILRYLGRKHNLCGETEEERIRVDTLENQVMDTRIHLMIVCCSPDF
EKQKPEFLKSIPEKMKIYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPECLDAFPN
LKDFLARFEGLKKISAYMKSSSFLPRPVFTKIPQWGTD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggctatgatactgggatattggaacgttcgcggacttactcaccccatccgcctgctc
ctggaatacacagattcaaactatgaggagaagagatacgtcatgggggatgcccccaac
tttgacagaagccagtggctgagtgagaaattcaatcttggcctggacattcccaatttg
ccctacttaattgatgggtcacacaaggtcacccagagcaatgccatcctgcgctacctt
ggccggaagcacaacctgtgtggggagacagaggaggagaggattcgtgtggacactttg
gagaaccaggtcatggacacccgcatacatctcatgatagtttgctgcagtcctgacttt
gagaagcagaagccagagttcttgaagtccatcccggagaagatgaaaatctattcagag
ttcctgggcaagcgaccatggtttgcaggggacaaggtcacctatgtggatttccttgct
tatgacattcttgaccagtaccgtatgtttgagcccgagtgcctggacgccttcccaaac
ctgaaggacttcctggcccgcttcgagggcctgaagaagatctctgcttacatgaagagt
agcagctttctcccaagacctgtgtttactaagataccgcagtggggcactgattag

DBGET integrated database retrieval system