KEGG   Rattus norvegicus (rat): 58919
Entry
58919             CDS       T01003                                 

Gene name
Ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04115  p53 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04340  Hedgehog signaling pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
rno04510  Focal adhesion
rno04530  Tight junction
rno04630  JAK-STAT signaling pathway
rno04917  Prolactin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno04921  Oxytocin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno05160  Hepatitis C
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05205  Proteoglycans in cancer
rno05206  MicroRNAs in cancer
rno05210  Colorectal cancer
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05214  Glioma
rno05215  Prostate cancer
rno05216  Thyroid cancer
rno05218  Melanoma
rno05219  Bladder cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05222  Small cell lung cancer
rno05223  Non-small cell lung cancer
rno05224  Breast cancer
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    58919 (Ccnd1)
   04340 Hedgehog signaling pathway
    58919 (Ccnd1)
   04390 Hippo signaling pathway
    58919 (Ccnd1)
   04371 Apelin signaling pathway
    58919 (Ccnd1)
   04630 JAK-STAT signaling pathway
    58919 (Ccnd1)
   04068 FoxO signaling pathway
    58919 (Ccnd1)
   04151 PI3K-Akt signaling pathway
    58919 (Ccnd1)
   04152 AMPK signaling pathway
    58919 (Ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    58919 (Ccnd1)
   04115 p53 signaling pathway
    58919 (Ccnd1)
   04218 Cellular senescence
    58919 (Ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    58919 (Ccnd1)
   04530 Tight junction
    58919 (Ccnd1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    58919 (Ccnd1)
   04921 Oxytocin signaling pathway
    58919 (Ccnd1)
   04919 Thyroid hormone signaling pathway
    58919 (Ccnd1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    58919 (Ccnd1)
   05206 MicroRNAs in cancer
    58919 (Ccnd1)
   05205 Proteoglycans in cancer
    58919 (Ccnd1)
   05203 Viral carcinogenesis
    58919 (Ccnd1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    58919 (Ccnd1)
   05212 Pancreatic cancer
    58919 (Ccnd1)
   05225 Hepatocellular carcinoma
    58919 (Ccnd1)
   05226 Gastric cancer
    58919 (Ccnd1)
   05214 Glioma
    58919 (Ccnd1)
   05216 Thyroid cancer
    58919 (Ccnd1)
   05221 Acute myeloid leukemia
    58919 (Ccnd1)
   05220 Chronic myeloid leukemia
    58919 (Ccnd1)
   05218 Melanoma
    58919 (Ccnd1)
   05219 Bladder cancer
    58919 (Ccnd1)
   05215 Prostate cancer
    58919 (Ccnd1)
   05213 Endometrial cancer
    58919 (Ccnd1)
   05224 Breast cancer
    58919 (Ccnd1)
   05222 Small cell lung cancer
    58919 (Ccnd1)
   05223 Non-small cell lung cancer
    58919 (Ccnd1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    58919 (Ccnd1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    58919 (Ccnd1)
   04934 Cushing syndrome
    58919 (Ccnd1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    58919 (Ccnd1)
   05162 Measles
    58919 (Ccnd1)
   05160 Hepatitis C
    58919 (Ccnd1)
   05163 Human cytomegalovirus infection
    58919 (Ccnd1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    58919 (Ccnd1)
   05169 Epstein-Barr virus infection
    58919 (Ccnd1)
   05165 Human papillomavirus infection
    58919 (Ccnd1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    58919 (Ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 58919
NCBI-ProteinID: NP_741989
RGD: 68384
Ensembl: ENSRNOG00000020918
UniProt: P39948
LinkDB
Position
1q42
AA seq 295 aa
MEHQLLCCEVETIRRAYPDTNLLNDRVLRAMLKTEETCAPSVSYFKCVQREIVPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEADENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAMQGLNLGSPNNFLSCYRTTHFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNIDPKATEEEGEVEEEAGLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggagaccatccgccgcgcgtaccctgacacc
aatctcctcaacgaccgggtgctgcgagccatgcttaagactgaggagacctgcgcgccc
tccgtttcttacttcaagtgcgtgcagagggagattgtgccatccatgcggaaaatcgtg
gccacctggatgctagaggtctgcgaggagcagaagtgcgaagaggaggtcttcccgctg
gccatgaactacctggaccgtttcttgtctctggagcccctgaagaagagccgcctgcag
cttctgggggccacctgcatgttcgtggcctctaagatgaaggagaccattcccctgact
gccgagaagttgtgcatctacactgacaactctatccgccccgaggagttgctgcaaatg
gaactgcttctggtgaacaagctcaaatggaacctggccgccatgactccccacgatttc
atcgaacacttcctctccaaaatgccagaggcggatgagaacaagcagatcatccgcaaa
catgcacagacctttgtggccctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggctgctgggagtgtggtggccgcgatgcagggcctgaacctgggcagcccc
aacaacttcctctcctgctaccgcacaacgcactttctttccagagtcatcaagtgtgac
ccggactgcctccgtgcctgccaggaacagattgaagcccttctggagtcaagcctgcgc
caggcccagcagaacatcgatcccaaggccaccgaggaggaaggggaagtggaggaagaa
gctggtctggcttgcacacccaccgacgtccgagatgtggacatctga

DBGET integrated database retrieval system