KEGG   Rattus norvegicus (rat): 60327Help
Entry
60327             CDS       T01003                                 

Gene name
F13a1, F13a
Definition
(RefSeq) coagulation factor XIII A1 chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    60327 (F13a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     60327 (F13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 60327
NCBI-ProteinID: NP_067730
RGD: 621495
Ensembl: ENSRNOG00000015957
UniProt: O08619 G3V811
LinkDB All DBs
Position
17p12
AA seq 732 aa AA seqDB search
MSDTPATTFGGRRAIPPNNSNAAEVDLPTEDLQGLVPRGVSLKDYLNVTAVHLFKERWDS
NKIDHHTDKYDNNKLIVRRGQTFYIQIDFNRPYDPRKDLFRVEYVIGRYPQENKGTYIPV
PVVTELQSGKWGAKVIMNEDRSVRLSVQSSPECIVGKFRMYVAVWTPYGILRTQRDPETD
TYILFNPWCEEDAVYLDDEKEREEYVLNDIGVIFHGDFNDIKSRSWSYGQFEDGILDACL
YVMDKAEMDLSGRGNPIKVSRVGSAMVNAKDDEGVLVGSWDNVYAYGIPPSAWTGSVDIL
LEYRSSETPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGS
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDLVYITAKKDGTHVVENVDATHIGKLIVTKEIGGDGMQDITD
TYKFQEGQEEERLALETALMYGAKKTLNTEGVVKSRSDVDMNFDVENAVLGKDFRVTITF
QNNSSNLYTILAYLSGNITFYTGVSKKEFKTESFEVTLDPLSLEKKEVLIRAGEYMSYLL
EQGLLHFFVTARINETRVVLAKQKSIVLTIPKVTIKVRGTAMVGSDMVVTVEFTNPLKET
LKNVWLHLEGPGVMRPKRKMFREIRPNATVQWEEVCQPWVSGHRKLIASMTSDSLRHVYG
ELDLQIRRRPTV
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatactccagcaactacctttgggggacggcgagcaatcccacccaacaactct
aatgcagcagaagtggacctcccgactgaggatctgcagggcctggtgcccaggggtgtc
agcctgaaagattacttgaatgtcacagctgttcacctgttcaaggagagatgggacagc
aacaagattgatcaccacacagacaaatatgacaacaataagttgattgtccgcagagga
cagactttctacatccagattgacttcaatcgcccatatgaccccaggaaggatctcttc
agagtggaatatgtcattggtcgctaccctcaggagaataagggcacctacatcccagtg
ccggtagtgacggagctgcaaagcggaaagtggggggccaaggttatcatgaatgaggac
aggtctgtgcggctttccgttcagtcttcccccgaatgcatcgtggggaaattccgcatg
tatgttgccgtctggactccctatggcatcctgcgtactcagagagacccggaaacagac
acatacattctcttcaatccttggtgcgaagaagacgctgtgtatctggatgatgagaaa
gaaagagaagagtacgtcctaaatgacatcggagtgatatttcatggggacttcaatgac
atcaagagcagaagctggagctatggccagtttgaagatggcatcctggacgcttgcttg
tatgtgatggacaaagctgagatggacctttctggcagagggaaccccatcaaagtcagc
cgagttggatcagcaatggtgaatgccaaggatgacgaaggtgttcttgttggatcatgg
gacaatgtctatgcctacggcatccctccatcagcctggacaggaagtgttgacattcta
ctagaatacagaagctcagaaacaccagtccgatatggccagtgctgggtttttgctggt
gtctttaacacatttttaaggtgccttggaatccctgcgagagtcattaccaattacttc
tcagcccacgacaatgatgccaatttgcaaatggacatcttcctggaagaagatgggagt
gtgagctccaaactcaccaaggattcagtgtggaactaccactgctggaatgaagcatgg
atgacgaggcctgatctccctgttggatttggaggatggcaagctgtggacagcacaccc
caagaaaacagcgatggcatgtaccgctgtggccctgcctctgttcaagccgttaagcac
ggccatgtctgcttccaatttgatgccccatttgtttttgcagaggtcaacagtgatctt
gtttacatcacagctaagaaagatggcacccacgtggtagagaacgtggatgccacccac
atcgggaagctaattgtgaccaaagaaattggaggagatgggatgcaggatatcacggat
acttacaaatttcaggaaggccaagaagaagagagactagcccttgaaactgccctgatg
tatggagccaagaagaccctcaatactgaaggcgtggtcaaatccagatctgatgtggac
atgaactttgatgtggaaaatgctgtgctgggaaaagacttcagagtgactatcaccttc
cagaacaatagctccaatctgtacaccatcctggcctatctttccggcaacatcaccttc
tacactggggtatccaagaaagagttcaagacagagtcctttgaagtgacgctggatccc
ttgtccttagagaaaaaggaggtgctgatcagagcaggcgagtatatgagctaccttctg
gaacagggcctcctgcacttcttcgtcactgcacgcatcaacgagaccagggtcgtcctg
gccaagcagaagtccatagtgctgactatccccaaggtcaccatcaaggtccgaggcact
gccatggttggctctgatatggttgtgactgttgagttcacaaatcctttgaaagaaacg
ctaaaaaatgtctggcttcacttggaaggtcctggagtgatgagacccaagaggaagatg
ttccgtgaaatccggcccaacgccactgtgcagtgggaagaagtctgtcagccttgggtc
tctggtcatcggaagctgattgccagcatgaccagtgactccctgagacatgtgtatgga
gagctggacctgcagattcgaagacgacctactgtataa

DBGET integrated database retrieval system