KEGG   Rattus norvegicus (rat): 60427
Entry
60427             CDS       T01003                                 

Gene name
Kitlg, Kitl, Mgf, SCF
Definition
(RefSeq) KIT ligand
  KO
K05461  KIT ligand
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04640  Hematopoietic cell lineage
rno04916  Melanogenesis
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60427 (Kitlg)
   04014 Ras signaling pathway
    60427 (Kitlg)
   04015 Rap1 signaling pathway
    60427 (Kitlg)
   04072 Phospholipase D signaling pathway
    60427 (Kitlg)
   04151 PI3K-Akt signaling pathway
    60427 (Kitlg)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    60427 (Kitlg)
  09152 Endocrine system
   04916 Melanogenesis
    60427 (Kitlg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60427 (Kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60427 (Kitlg)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   60427 (Kitlg)
SSDB
Motif
Pfam: SCF Psg1
Other DBs
NCBI-GeneID: 60427
NCBI-ProteinID: NP_068615
RGD: 3086
Ensembl: ENSRNOG00000005386
UniProt: P21581
LinkDB
Position
7q21
AA seq 273 aa
MKKTQTWIITCIYLQLLLFNPLVKTQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAG
MDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAP
KNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQQKEREFQEV
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctctcgtcaaaactcaggagatctgcaggaatcctgtgactgataatgtaaaagacatt
acaaaactggtggcgaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggttacgagatatggtaacacacttatcagtcagc
ttgactactcttctggacaagttttcaaatatttctgaaggcttgagtaattattccatc
atagacaaacttgggaaaatagtggatgacctcgtggcatgtatggaagaaaatgcacct
aagaatgtaaaagaatcactgaagaagccagaaactagaaactttactcctgaagaattc
tttagtattttcaatagatccattgatgccttcaaggacttcatggtggcatctgacact
agtgattgtgtgctctcttcaacattaggtcctgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagttcccttaggaatgacagcagtagcagt
aataggaaagccgcaaagtcccctgaagacccaggcctacaatggacagcaatggcactg
ccggctctcatttcgcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagagagagagtttcaagaggtgtaa

DBGET integrated database retrieval system