KEGG   Rattus norvegicus (rat): 63889
Entry
63889             CDS       T01003                                 

Gene name
Ptgdrl, Ptgdr, Ptgdr2
Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    63889 (Ptgdrl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    63889 (Ptgdrl)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    63889 (Ptgdrl)
SSDB
Motif
Pfam: 7tm_1 ResB
Other DBs
NCBI-GeneID: 63889
NCBI-ProteinID: NP_071577
RGD: 619707
UniProt: O35932
LinkDB
Position
15p14
AA seq 357 aa
MNESYRCQAATWVERGSSATMGGVLFSAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTHLLGKCLISPMVLAAYAQNRSLKELLPASGNQLCEAFAFLMSFFGLASTL
QLLAMALECWLSLGHPFFYQRHITARRGVLVAPVAGAFSLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKKRSFSVIGFSVLYSSLMALLVLATVVCNLGAMSNLYAMHRRQRHHPRRCSR
DRAQSGSDYRHGSPNPLEELDHFVLLALTTVLFTMCSLPLIYRAYYGAFKLVDRADGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKAFTRPLIYRNWCSHSWQTNMESTL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaatgagtcctatcgctgtcaggcagccacctgggtggaacggggctcctcagcgaca
atgggtggtgtgctcttcagtgcaggactgctgggcaatctcctggcgctggtgctgctg
gcgcgatccgggctggggtcctgccggccagggccactgcatccgccgccctcggtcttt
tatgtgctagtgtgcggcttgacggtcacccacttgctgggcaagtgtctgatcagcccg
atggtcctggctgcctacgcgcaaaatcggagcctaaaggaactgctgcctgcctcaggc
aatcagttatgtgaagccttcgccttcctgatgtccttctttgggttagcctcgacctta
cagctactggctatggcactggagtgctggctgtctctgggacaccctttcttctaccaa
aggcacatcaccgcccgccggggagtgctggtggcgccagtcgcaggcgccttctctttg
gctttctgtgcgctcccctttgctggctttgggaagttcgtgcagtactgtccaggtacc
tggtgcttcatccagatgatccacaagaagcgctcattctcggtaataggcttctctgtg
ctctactccagcctcatggcgctgctggtcctcgcaactgtggtgtgcaacctgggtgcc
atgtccaacctctatgccatgcacaggcgccagaggcaccatccccgccgctgctccagg
gaccgcgcccagtcaggctcagactacaggcatgggtccccgaatcctttggaggagctg
gaccactttgttctgctggctctcacgacagtgctcttcaccatgtgttccctgccttta
atttatcgtgcttactatggagcctttaaacttgtggacagagctgacggagactcggaa
gacctccaagccttgcgttttctgtctgtgatttccatcgtggacccctggatcttcatc
attttcaggacttcagtattccggatgttatttcacaaggctttcacaagacctctgatc
tacagaaactggtgcagccattcctggcagactaacatggaatccactttgtga

DBGET integrated database retrieval system