KEGG   Rattus norvegicus (rat): 65271Help
Entry
65271             CDS       T01003                                 

Gene name
Mgat5
Definition
(RefSeq) mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase
  KO
K00744  alpha-1,3(6)-mannosylglycoprotein beta-1,6-N-acetyl-glucosaminyltransferase [EC:2.4.1.155]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00510  N-Glycan biosynthesis
rno01100  Metabolic pathways
Module
rno_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    65271 (Mgat5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    65271 (Mgat5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.155  alpha-1,6-mannosyl-glycoprotein 6-beta-N-acetylglucosaminyltransferase
     65271 (Mgat5)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  N-Glycan
   65271 (Mgat5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_18 DUF4525
Motif
Other DBs
NCBI-GeneID: 65271
NCBI-ProteinID: NP_075583
RGD: 620100
Ensembl: ENSRNOG00000003614
UniProt: Q08834 A9CMA3
LinkDB All DBs
Position
13q12-q13
AA seq 740 aa AA seqDB search
MAFFSPWKLSSQKLGFFLVTFGFIWGMMLLHFTIQQRTQPESSSMLREQILDLSKRYIKA
LAEENRNVVDGPYAGVMTAYDLKKTLAVLLDNILQRIGKLESKVDNLVNGTGANSTNSTT
AVPSLVSLEKINVADIINGVQEKCVLPPMDGYPHCEGKIKWMKDMWRSDPCYADYGVDGT
SCSFFIYLSEVENWCPRLPWRAKNPYEEADHNSLAEIRTDFNILYGMMKKHEEFRWMRLR
IRRMADAWIQAIKSLAEKQNLEKRKRKKILVHLGLLTKESGFKIAETAFSGGPLGELVQW
SDLITSLYLLGHDIRISASLAELKEIMKKVVGNRSGCPTVGDRIVELIYIDIVGLAQFKK
TLGPSWVHYQCMLRVLDSFGTEPEFNHASYAQSKGHKTPWGKWNLNPQQFYTMFPHTPDN
SFLGFVVEQHLNSSDIHHINEIKRQNQSLVYGKVDSFWKNKKIYLDIIHTYMEVHATVYG
SSTKNIPSYVKNHGILSGRDLQFLLRETKLFVGLGFPYEGPAPLEAIANGCAFLNPKFNP
PKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVDLNNREEVEDAVKAILNQKIEP
YMPYEFTCEGMLQRINAFIEKQDFCHGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICE
PSFFQHLNKEKDLLKYKVICQSSELYKDILVPSFYPKSKHCVFQGDLLLFSCAGAHPTHQ
RICPCRDFIKGQVALCKDCL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggctttcttttctccctggaagttgtcctctcagaagctgggctttttcttggtgact
tttggcttcatatgggggatgatgcttctacacttcaccatccagcagcgaactcagcct
gagagcagctccatgttgcgggagcaaatccttgacctcagcaaaaggtacattaaggca
ctggcagaagagaacaggaacgtggtggatggcccgtatgccggtgtcatgacagcctat
gatctgaagaaaacgctcgccgtgctgctggataacatcttgcagcgcatcggcaagctg
gagtccaaggtggacaatcttgtcaacggcacaggagcgaattctaccaactccaccacg
gctgtccccagcttggtgtcactggagaaaattaatgtggcagatatcattaatggagtt
caagaaaaatgtgtattgcctcctatggatggctacccccactgcgaggggaaaatcaag
tggatgaaagacatgtggcggtcagacccctgctacgcagactatggagtggacgggacc
tcctgctccttttttatttacctcagtgaggttgaaaattggtgtcctcgtttaccttgg
agagcaaaaaatccctatgaagaagctgaccataactcattggcagaaatccgcacggat
tttaacattctctacggcatgatgaagaagcatgaggagttccggtggatgagacttcgg
atccggcgaatggctgatgcatggatccaagcaatcaagtctctggcagagaaacaaaac
ctagagaagaggaaacggaagaaaatccttgttcacctggggctcctgaccaaggaatca
ggcttcaagattgcagagacagcattcagcggtggccctctcggcgagctcgttcagtgg
agtgacttaatcacatctctgtacctgctgggccatgacatccgcatctcagcctcgctg
gctgagctcaaggagattatgaagaaggttgttggaaaccggtctggctgtccaactgta
ggagacagaatcgttgagcttatttatatcgatattgtgggacttgctcaattcaagaaa
acgctaggaccatcctgggttcattaccagtgcatgctccgggtgctggactcctttgga
acagaacctgagttcaatcacgcaagttacgcccagtcgaaaggccacaagaccccctgg
ggaaagtggaatctgaacccgcaacagttttacaccatgttccctcataccccagacaac
agctttctgggcttcgtggtcgagcagcacctgaactccagcgacatccaccacattaac
gagatcaaaaggcagaaccagtcccttgtgtatggcaaagtggatagtttctggaagaat
aagaagatctacttggacatcattcacacgtacatggaagtgcacgccactgtttacggc
tccagtaccaagaacatccccagttacgtgaaaaaccatggcattctcagcggccgtgac
ctacagtttcttctccgggaaaccaagctttttgttgggcttggattcccttatgaaggt
ccagctcccctggaagccatcgcgaatggatgtgctttcctgaaccccaagttcaaccct
cctaaaagcagcaaaaacacagacttcttcattggcaagccaacactgagagagctcaca
tcccagcacccgtacgcagaagtcttcatcggccggccacacgtctggaccgtggacctc
aataaccgagaggaagtagaagacgcagtaaaagccatcttaaaccagaagattgagccg
tatatgccatatgagttcacatgtgaaggcatgctgcagagaatcaacgctttcatcgag
aaacaggacttctgccacggccaagtgatgtggccgccccttagcgccctgcaggtgaag
ctggctgagcccgggcagtcctgcaaacaggtgtgccaggagagccagctcatctgcgag
ccgtccttcttccagcacctcaacaaggaaaaggacctgctgaagtataaggtaatctgc
caaagctcagaactatacaaggacatcctggtgccctccttctaccccaagagcaagcac
tgtgtgttccaaggggatctcctgctcttcagttgtgccggggcccaccccacacaccag
cggatctgcccctgccgggacttcatcaagggccaagtggccctctgcaaagactgccta
tag

DBGET integrated database retrieval system