KEGG   Rattus norvegicus (rat): 689883Help
Entry
689883            CDS       T01003                                 

Gene name
Setdb1
Definition
(RefSeq) SET domain, bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    689883 (Setdb1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    689883 (Setdb1)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     689883 (Setdb1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     689883 (Setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    689883 (Setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537 53-BP1_Tudor
Motif
Other DBs
NCBI-GeneID: 689883
NCBI-ProteinID: NP_001258104
RGD: 1308370
Ensembl: ENSRNOG00000021143
UniProt: D4A081
LinkDB All DBs
Position
2q34
AA seq 1302 aa AA seqDB search
MSSLPGCMSLAAAPAAADSAEIAELQQAVVEELGISMEELRQFIDEELEKMDCIQQRKKQ
LAELETWVLQKESEVAYVDRLFDDASREVTNCESLVKDFYSKLGLQYHDSSSDDEASQPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLGQVSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGLGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDSSCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASAMEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGIQFKPMEPLQPIVPPAPLPMLPLSPQAGDSESLESQL
AQSRKQVAKKSTSFRPGSVSSGHSSPTSPTLSENVPPGKIGMNQTYRSPSASVTSTPAPA
APSGPPAPPGPLAPPGPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRP
MRNEQYRGKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFET
GCDFLYLEMFCLDPYVLVDRKFQPFKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYS
KERIPGKGVFINTGPEFLVGCDCKDGCRDKSKCACHQLTVQATACTPGGQINPSSGYQHK
RLEECLPTGVYECNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSF
VCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDVPSSSDSSGVDMKDQ
EDGNSGSEDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKESELSEVTSKDSR
APDRGPPHVPITPSGSVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSRSSFKTSE
GGDGRAGGGRGEAERASTSGLSFKDEGDSKQSKKEDPEDRNKMSVVTEGSQNHGHNPPMK
SEGLRRPASKISMLQSQRVVTSTQSNPDDILTLSSSTESEGESGTSRKPTTGQTSATAVD
SDDIQTISSGSDGDDFEDKKNLSGPTKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGE
SAPVRKNTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAF
FASKRIRAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcatgagtttggctgcagcgccagctgcggcggactctgca
gagattgctgagctgcagcaggcagtggttgaagagctgggtatctctatggaggaactt
cgtcagttcatcgatgaagaactggaaaagatggactgtatacagcagcgcaagaagcag
ctggcagagctggagacgtgggtgctgcagaaggagtctgaggtggcttatgttgatcgg
ctgtttgatgatgcatctagggaagtgactaattgtgagtctttggtgaaggatttctac
tctaagctgggattacagtatcatgacagtagctctgacgatgaagcttcccagcctaca
gagataatcgagattcctgatgaagatgatgatgtcctcagtattgattcaggtgatgct
gggagcagaacgccaaaagatcagaagcttcgtgaagctatggctgccttaagaaaatca
gctcaagatgtccagaagttcatggatgctgtgaataagaaaagcagttctcaagatcta
cataaaggaaccttgggtcaggtgtctggagaactgagcaaagatggggacctgatagtc
agcatgcggattctgggcaagaagaggactaagacgtggcacaaaggcaccctcattgcc
atccagactgtcgggctaggaaagaaatacaaagtgaaatttgacaacaaaggaaagagt
ctgctgtctgggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgagtggtggccaaatacaaagatggaaatcaggtctggctttatgctggcatt
gtagctgagacccctaacgtcaagaacaagctcagatttttaattttttttgatgatggc
tatgcttcctatgtcactcagtccgagctgtatcccatttgccgaccattgaaaaagact
tgggaggacatagaagacagctcctgccgagacttcatagaagaatatatcactgcctat
ccaaaccgcccaatggtacttctcaagagtggccagcttattaagactgagtgggaaggc
acatggtggaagtctcgagttgaagaggttgatggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgagtggatctatcgaggctctacacgcctggaacctatgttcagt
atgaagacatcctcagcctctgcaatggagaagaagcaaggggggcaactcagaacccgt
cctaatatgggtgctgtgaggagcaaaggtcctgttgttcagtacactcaggatctaacg
agtactggaatccagtttaagcccatggagcccctgcagcctatagtcccacctgccccg
cttcccatgcttcctctttccccccaggcaggcgacagtgaaagcttagaaagccagctt
gctcaatcacggaagcaagtagccaaaaagagcacatcattccgaccaggatctgtgagt
tctggccattcctcccctacttcgcccacactcagtgaaaatgtaccccctgggaaaatt
ggaatgaaccagacatacagatcaccttcagcctctgtaacatctaccccagcacctgca
gccccttctgggcctccagcccctccagggcctcttgctcctcctggaccaccggcccct
ccagctttccacggcatgttagagcgggcaccagctgagccctcctatcgtgcccctatg
gagaagcttttctatttacctcatgtctgcagttacacttgtttgtcccggattagaccc
atgaggaatgaacaatatcggggcaaaaaccctctactggtcccactattgtatgacttc
cggaggatgacagcacgtcgcagagttaaccgcaagatgggcttccatgtaatctataag
acaccctgtggtctctgccttcggacgatgcaggaaatagagcgctacctttttgagact
ggctgtgacttcctgtacctggagatgttctgtttggatccatatgtccttgttgacaga
aagttccagccctttaaacctttttactatattttggacatcacctatggcaaagaagat
gttcccctgtcctgtgttaatgagattgacacaactcccccaccccaggtggcctacagc
aaggaacgcattcctggcaagggtgttttcattaacacaggccctgaatttctggttggc
tgtgactgcaaggatgggtgtcgggataaatccaagtgtgcctgccatcagctcactgtc
caggccacagcctgtaccccagggggtcagatcaaccctagctccggctaccagcacaaa
agactagaagagtgtctgcccacaggggtttatgagtgtaacaagcgctgcaaatgtgac
ccaaacatgtgcacaaatcggttggtgcagcatggactgcaggttcgactacagctgttt
aagacacagaacaagggctggggcatccgctgcttggatgacattgctaaaggctctttt
gtctgcatttatgcaggcaaaatcctgacagatgactttgcagacaaagaaggcctcgag
atgggtgatgagtactttgcaaatctggaccacattgaaagtgtggagaacttcaaggaa
ggatatgagagtgacgtccccagctcctctgacagcagtggggtggatatgaaggaccag
gaggatggcaacagtggctcagaggaccctgaggagtccaacgacgacagctccgatgac
aacttctgtaaggacgaggacttcagcaccagttcagtgtggcgtagctatgcaacccgg
aggcagactcggggtcagaaggagagtgaactgtctgaggtgacttcaaaggactcccgc
gccccagaccgtgggcctccccacgtccctatcactccctcaggatctgtagggggttgc
aatccaccttcctccgaagagacacccaagaacaaggtggcctcatggttgagctgcaat
agtgtcagtgaaggtggatttgctgactctgacagccgttcctcctttaagactagtgaa
ggtggagatggccgtgctgggggaggccggggagaggctgaaagagcctctacctcagga
ttgagcttcaaggatgaaggagacagtaagcaatctaaaaaagaggaccctgaggaccga
aacaagatgtcagtagttactgaaggctctcagaatcatggacacaatcctcccatgaag
tctgaagggcttcgccgaccagctagtaaaatttctatgctccagagccagcgagttgtg
acttctactcagtcaaaccctgatgatatcctaacactgtccagcagcacagaaagtgag
ggggaaagtggaaccagccgaaagcccactactggtcagacttcagccacagcagttgac
agtgatgacatccagaccatctcttctggctctgatggcgatgactttgaggacaagaag
aacttgtcgggaccaacaaagcgtcaggtggcagtaaaatcaacccgaggctttgctctt
aaatcaacccatggtattgccattaaatcaaccaacatggcttccgtggacaagggggag
agtgcaccagttcgtaagaacacacgccagttctatgatggtgaagagtcttgctacatc
attgatgccaaacttgaaggcaacctaggccgctacctcaatcacagttgcagccccaac
ctgtttgtccagaacgtttttgtggatacccatgatcttcgcttcccttgggtggccttt
tttgccagcaagagaatccgggctggaacagaactcacttgggattacaactatgaagtg
ggcagtgtggaaggcaaggaactgctgtgctgctgtggagccattgaatgcagagggcgg
cttctctag

DBGET integrated database retrieval system