KEGG   Rattus norvegicus (rat): 691086
Entry
691086            CDS       T01003                                 

Gene name
Nlrp4f
Definition
(RefSeq) NLR family, pyrin domain containing 4F
  KO
K22265  NACHT, LRR and PYD domains-containing protein 4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    691086 (Nlrp4f)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    691086 (Nlrp4f)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   Others
    691086 (Nlrp4f)
Pattern recognition receptors [BR:rno04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   691086 (Nlrp4f)
SSDB
Motif
Pfam: NACHT PYRIN NLRC4_HD2 NOD2_WH LRR_6 NB-ARC AAA_16 AAA_30
Other DBs
NCBI-GeneID: 691086
NCBI-ProteinID: XP_001076792
RGD: 1588619
Ensembl: ENSRNOG00000059733
LinkDB
Position
1
AA seq 838 aa
MASFSSDFSLVWYLKELNQKEFMKFKDFLIQEILELKLKQISWTEVKKASREGLSNLLLK
CYGENQALDMTFKILQKINRKDLTKKATREIAENSKLYREHLKKKLSHNCSKMFNINIQD
FILETVIQDDYDTFENLLVSKGDEKKPHMVFLKGMAGIGKTLMLKNVMLAWAKGLVFQNK
FSYTFYFCCQDVKQLKTASLAELISREWPISSAPIEEILSQPEKLLFIIDSLEGMEWDLT
KQESELCGNCTEKQPVSLLLSSLLRRKMLPESSFLISATPETFEKMEDRIRCTDVKTATA
FNERSIEICFHRLFQDRNTAQKAFSLVRENEQLFTLCQAPLLCWMVATCLKKEIEKGKDP
VSICRHITSLYTTYIFNSFIPQSAKYPSKKSQDQLQGLCSLAAEGMWTDTFVFSEEALRR
NGIMDSDIPTLLDIGMLGKIREFENSYLFLHPSVQEICAAIFYLLKSHGVHPSQDVKSVE
TVLFMFLKKVKTQWILWGSFIFGLLHKSEQEKLAVFFGYQLSQKIRHKLYQCLETINGNV
ELQEQIDGMKLFYCLFEMEDDAFLVKAVNCMQQINFVANYYSDFFVAAYCLKRCSTLKKL
SFSTQNALNEELEQQYRERLLICWNDICSVFVRSKNIQTLQIKDTNFSEPTFRVLYESLK
YPSFPLSKLVANNVHFFGDNHMFFELIQNHNLQYLDLSCSSLSPNGVKLLFDVLNQAECN
IEKLMVAHCKLSPDDCKIFGSILMSSKTLKILNLASNNLNQGISSLCEGLCHPNCVLEYL
VLANCSLSEQCWDYLSDVLRKNKTLNHLDISCNDLKDKGIKILCKALTLPDCFMKSLW
NT seq 2517 nt   +upstreamnt  +downstreamnt
atggcatctttcagttcagatttcagccttgtatggtacttgaaagaactaaaccagaag
gaattcatgaagtttaaggactttctcatacaggagattctggaactgaagctgaaacag
atttcttggactgaagtgaagaaagcatctcgggaaggtcttagcaacttacttctgaaa
tgttatggggagaatcaagccttggatatgaccttcaaaatcctccagaagatcaataga
aaagatctcactaagaaggcaacaagagagattgctgaaaactcaaagctttatcgagaa
cacttgaagaagaagctgtcccataattgttccaaaatgttcaacatcaatattcaagat
ttcattctggagacagtcattcaggatgactatgatacttttgagaaccttcttgtatca
aagggagatgaaaagaagccacacatggtgttcctgaaaggcatggctggaattggcaag
acgctgatgttgaaaaatgtaatgctggcctgggcaaaaggtctggtgtttcaaaacaaa
ttctcatacaccttctacttttgttgtcaagatgtgaagcagttgaagacagcaagcctt
gctgaacttatctccagagagtggcccatctcctcagctcctatagaggagattctgtcc
caacctgagaaactcttatttatcattgacagcttggaagggatggaatgggatttaacc
aaacaggaatcggagctgtgtggtaactgcacggagaagcagcccgtgagtttactgctg
agcagtttgctcaggaggaagatgctccccgaatcctctttcctcatctccgctacccca
gagacttttgagaaaatggaggacaggattcggtgcacagatgtgaaaacagcaactgca
ttcaatgagagaagtattgagatatgtttccacagattgttccaagataggaacacagcc
cagaaggccttcagtttggtaagagaaaatgagcagctattcactctgtgccaggcccct
ctgctctgctggatggtggccacctgtttaaaaaaggagatagagaagggaaaagaccca
gtctccatctgccgacatatcacttccctgtataccacttatatcttcaattcattcatt
ccccaaagtgccaaatatccaagtaagaaaagccaagaccagctgcagggcttgtgttct
ctagcggccgagggcatgtggaccgacacattcgtgtttagtgaggaggcgctccggaga
aatggaatcatggactctgacatccccacactattggacattggcatgcttggaaagatc
agagagtttgaaaattcttacctattcctccacccatcggttcaggagatctgtgctgcc
atcttttatctgctaaagagccatggagtccaccctagccaggatgtgaaaagtgtagag
acagtcttgtttatgtttttaaagaaagtaaaaacacagtggattctttggggcagtttc
atcttcggccttttgcacaaatcagaacaagaaaagctagcagtgttttttggctaccag
ttgtcccagaaaatacggcataagttatatcagtgtctggaaacaataaatggcaatgta
gaactccaagaacaaatagatggcatgaaattgttttactgtctgtttgagatggaagat
gacgccttcctcgtgaaagcagtgaattgtatgcagcaaattaacttcgtggctaattat
tattctgatttttttgttgctgcctattgcttgaaacgctgttctacactgaagaaacta
tccttttcaacccaaaatgccctgaatgaagaattagaacagcagtatagggaaaggcta
ctcatttgttggaatgatatatgctctgtgtttgtaaggagtaaaaacatccagacactc
caaataaaagacactaatttcagtgagccaacttttcgggtcttgtatgaatctctgaag
tacccaagcttccctcttagcaaacttgtggcaaataatgtgcacttctttggtgataac
cacatgttctttgagttgattcagaatcacaatttacagtacttggacctcagctgctca
tccctgtcccccaatggagtgaaactattgtttgatgtcttgaaccaggcagagtgcaac
atagaaaaacttatggtagcacactgtaagctttcacctgatgactgcaagatctttggc
tccatcctgatgagcagcaagacattgaaaattcttaatttggcatccaacaatttgaac
caaggaatatcctcattgtgcgagggtttgtgccacccaaattgcgttctggagtactta
gttttggccaactgttccctcagtgagcaatgttgggactacctttctgatgttcttagg
aagaacaaaactctgaaccatctagacatcagctgcaatgacctgaaggataaaggaatc
aagattctctgtaaagctctgactctcccagactgtttcatgaagtcactatggtag

DBGET integrated database retrieval system