KEGG   Rattus norvegicus (rat): 81513Help
Entry
81513             CDS       T01003                                 

Gene name
Lig1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03030  DNA replication
rno03410  Base excision repair
rno03420  Nucleotide excision repair
rno03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    81513 (Lig1)
   03410 Base excision repair
    81513 (Lig1)
   03420 Nucleotide excision repair
    81513 (Lig1)
   03430 Mismatch repair
    81513 (Lig1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    81513 (Lig1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    81513 (Lig1)
Enzymes [BR:rno01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     81513 (Lig1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     81513 (Lig1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     81513 (Lig1)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    81513 (Lig1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     81513 (Lig1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     81513 (Lig1)
   NER (nucleotide excision repair)
    Other NER factors
     81513 (Lig1)
   MMR (mismatch excision repair)
    Other MMR factors
     81513 (Lig1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 81513
NCBI-ProteinID: NP_001019439
RGD: 621424
Ensembl: ENSRNOG00000014193
UniProt: Q566D8
LinkDB All DBs
Position
1q21
AA seq 913 aa AA seqDB search
MQRSIMSFFQPTTTEGKAKKPEKEIPSSIREKEPPPKVALKERNRAVPESDSPVKRPGRK
VAQVLSSEGEDEDEAPGTPQVQKPVSDSKQSSPPSPDSCPENSSPSMDISPSGFPKRRTA
RKQLPKRTIQDTLEEHNEDKDKAAKKRKKEDTQTPTESLTEAEEVKQKEEQVEDQPTVPP
EPTESPESVTLTKTENIPMCKAGVKQKPQEEEQSKPPARGAKPLSSFFTPRKPAVKTEVK
QEESDTPRKEETKGAPDPTNYNPSKSNYHPIEDACWKHGQKVPFLAVARTFEKIEEVSAR
LKMVETLSNLLRSVVALSPTDLLPVLYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGRQ
LESIRAEVAEKGDVGLVAENSRSTQRLMLPPPPLTVSGVFTKFCDIARLTGSASMAKKMD
IIKGLFVACRYSEARFIARSLSGRLRLGLAEQSVLAALAQAVSLTPPGQEFPTAVVDAGK
GKTAEARKMWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLESLPEHCKLSPGVPLKPMLA
HPTRGVREVLKRFEEVDFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNSGKYPDIISRI
PKIKHPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYL
NGESLARQPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCEGLMVK
TLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAYDE
ESEELQAICKLGTGFSDEELEEHHQSMQALLLPTPRPYVRIDGAVAPDHWLDPSVVWEVK
CADLSLSPIYPAARGLVDKEKGISLRFPRFIRVREDKQPEQATTSDQVASLYRKQSQIQN
QQSSDLDSDVEDY
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgcagagaagtattatgtcatttttccaacccacaacaacagaaggtaaagcgaagaag
ccagagaaggagatacccagcagcatcagagagaaggaaccccctccaaaggtggcattg
aaggagaggaatcgagcagtgcctgagagtgattctccagtgaagaggccaggaaggaag
gtggcccaggttctgagcagtgaaggggaggacgaagatgaagcccctggcaccccccaa
gtccaaaagcctgtgtcagactccaaacagagctctcctcccagccctgactcctgtcct
gagaacagcagcccctccatggacatctccccatcaggattcccaaagcgccgaactgca
cggaagcagctcccaaaacggacaattcaagacactcttgaggagcacaatgaagacaaa
gacaaagcagctaagaaaaggaaaaaagaagatacacagaccccaacagaaagcctcaca
gaggctgaagaagtaaaacagaaggaagaacaggtggaggaccagcccacagtaccccct
gagcccacagagtcccctgagtcagtaaccctcacaaagacagagaacattccaatgtgt
aaggcaggtgtgaaacagaagcctcaggaagaagaacagagcaagcctcctgccaggggt
gccaagccactgagcagtttcttcacaccccgaaaaccagcagtgaaaactgaagtcaaa
caagaagagtcagacactccaaggaaggaagagaccaagggagccccggatccaaccaat
tataatccttccaagagtaactaccatcccattgaagatgcctgctggaaacatggccaa
aaggttccttttcttgctgtggcccggacatttgagaagattgaggaggtgtctgctcgg
cttaagatggtggagacactgagcaacctgctgcgctccgtggtggccctgtccccaaca
gacctgctccctgttctctatctcagcctcaaccgccttgggccgcctcagcagggtcta
gaactgggtgttggtgatggtgtcctcctcaaggcagttgcccaggccacaggtcgtcag
ctggagtccatccgggctgaggtagctgagaagggggatgtggggctagtggcggagaac
agccgaagcactcagaggctcatgctgcctccacctccacttactgtttctggagtcttt
accaaattctgtgacattgcccggctcactggcagtgcttccatggccaagaaaatggac
attatcaagggcctttttgttgcctgccgctactcagaagcccggtttattgccaggtcc
ctaagtgggcggctgcgccttgggctggctgagcagtcagtactggctgctcttgcccag
gctgtgagcctcacaccccctggccaagaatttcccacagccgtggtggatgctgggaag
ggcaagacagcagaggccagaaagatgtggttggaagaacaaggcatgatcttgaagcaa
accttctgtgaggtgcctgatctggatcgcatcatccctgtgctgctggaacatggcttg
gaaagtctcccagagcactgcaagctgagcccaggggttcctcttaaaccaatgctggcc
catcccactcggggtgtccgtgaggtcctgaaacgctttgaggaggtcgacttcacctgc
gagtataaatacgatgggcagcgggcacagatacatgttctggaaggtggagaagtgaag
atcttcagcaggaaccaggaagacaactcaggaaagtatcctgacatcatcagccgcatc
cccaagattaaacacccctcagtcacatctttcattctggacactgaggctgtggcctgg
gaccgggaaaagaagcagatccagccattccaagtgctcaccacacgcaagcgcaaggag
gttgatgcatcggagatacaggtacaagtgtgtctgtatgcttttgacctcatctacctc
aacggagagtccctggctcgccagcccctgtctcgacgccggcagctactccgtgagaac
tttgtggagacagagggtgagtttgtctttgccacctccttggacaccaaggacatcgag
cagattgccgagttcttagagcagtcagtgaaggactcctgtgagggcctgatggtgaag
accctggatgttgatgctacctatgagatcgccaagaggtcacacaactggctcaagctg
aagaaggactaccttgaaggtgtgggcgacactctagaccttgtggtgattggtgcctac
ctgggccgggggaagcgggctggccggtatgggggcttcctgttggctgcctacgatgag
gagagtgaagagctgcaggccatatgcaagctgggaaccggattcagcgacgaggagctg
gaagaacatcatcagagcatgcaggcccttttattgcctaccccacgcccctatgtgagg
attgatggggcagtggccccagaccactggctagacccgagtgttgtgtgggaggtgaaa
tgtgctgatctctccctgtctcccatctaccctgctgctcggggcctggtggacaaagaa
aaagggatctcccttcgtttccctcggttcattcgtgtccgtgaggataagcagccagag
caggccactaccagtgaccaggtggcctctttgtaccggaagcagagtcagattcagaac
cagcaaagctcagacttggactctgatgttgaagattactaa

DBGET integrated database retrieval system