KEGG   Rattus norvegicus (rat): 83523Help
Entry
83523             CDS       T01003                                 

Gene name
Impa1, Impa1-L
Definition
(RefSeq) inositol monophosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    83523 (Impa1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    83523 (Impa1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     83523 (Impa1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 83523
NCBI-ProteinID: NP_114446
RGD: 69254
Ensembl: ENSRNOG00000010482
UniProt: P97697
LinkDB All DBs
Position
2q23
AA seq 277 aa AA seqDB search
MADPWQECMDYAVILARQAGEMIREALKNKMDVMIKSSPADLVTVTDQKVEKMLMSSIKE
KYPYHSFIGEESVASGEKTVFTEQPTWIIDPIDGTTNFVHRFPFVAVSIGFVVNKEMEFG
VVYSCVEDKMYTGRKGKGAFCNGQKLRVSQQEDITKSLLVTELGSSRKPETLRIVLSNME
RLCSIPIHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDMAGAGIIVIEAGGVLLDVTG
GPFDLMSRRIIAASNIALAERIAKELEIIPLQRDDES
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcagacccttggcaggagtgcatggattatgcagtgatcctcgcaagacaagctgga
gagatgattcgtgaagctctaaaaaataagatggatgtcatgattaaaagttctccagcc
gacttggtaacagttactgaccaaaaagttgaaaagatgcttatgtcttctataaaggaa
aaatacccatatcacagtttcattggtgaagaatctgtggcatccggggaaaagacagtc
ttcacagagcagcccacgtggatcattgatcccattgacgggacgaccaactttgtgcac
cggtttccctttgtagctgtttcgattggcttcgttgtaaataaagagatggagtttgga
gttgtatacagctgtgtggaagataagatgtatacgggcaggaaaggaaaaggcgccttt
tgtaacggtcagaagcttcgggtctcgcagcaggaagacattaccaaatcactcttggtg
accgagctgggctcgtccagaaagccggagactttgcggattgttctctccaacatggaa
aggctttgctccattcctatccatggaatccggagtgttgggacagcggctgttaatatg
tgccttgtggcaacgggaggagcggatgcctattacgagatggggatccactgctgggac
atggctggagctggcatcatcgtcatagaggctggcggagtgctgctggatgtgacaggt
ggaccattcgatttgatgtctcggagaataattgctgcaagtaatatagcattagcagaa
agaatagccaaagaacttgagataatacctttacaacgagacgacgaaagttag

DBGET integrated database retrieval system