KEGG   Rattus norvegicus (rat): 83571
Entry
83571             CDS       T01003                                 

Gene name
Cdkn1b, CDKN4, Cdki1b, Kip1, P27KIP1, p27
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04012  ErbB signaling pathway
rno04066  HIF-1 signaling pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04151  PI3K-Akt signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno04934  Cushing syndrome
rno05162  Measles
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05206  MicroRNAs in cancer
rno05215  Prostate cancer
rno05220  Chronic myeloid leukemia
rno05222  Small cell lung cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    83571 (Cdkn1b)
   04066 HIF-1 signaling pathway
    83571 (Cdkn1b)
   04068 FoxO signaling pathway
    83571 (Cdkn1b)
   04151 PI3K-Akt signaling pathway
    83571 (Cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    83571 (Cdkn1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83571 (Cdkn1b)
   05202 Transcriptional misregulation in cancer
    83571 (Cdkn1b)
   05206 MicroRNAs in cancer
    83571 (Cdkn1b)
   05203 Viral carcinogenesis
    83571 (Cdkn1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    83571 (Cdkn1b)
   05220 Chronic myeloid leukemia
    83571 (Cdkn1b)
   05215 Prostate cancer
    83571 (Cdkn1b)
   05222 Small cell lung cancer
    83571 (Cdkn1b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    83571 (Cdkn1b)
   04934 Cushing syndrome
    83571 (Cdkn1b)
  09172 Infectious disease: viral
   05162 Measles
    83571 (Cdkn1b)
   05169 Epstein-Barr virus infection
    83571 (Cdkn1b)
   05165 Human papillomavirus infection
    83571 (Cdkn1b)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    83571 (Cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 83571
NCBI-ProteinID: NP_113950
RGD: 69062
Ensembl: ENSRNOG00000007249
UniProt: O08769
LinkDB
Position
4q43
AA seq 197 aa
MSNVRVSNGSPSLERMDARQTEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVPAQESLDVSGSRQAVPSIG
SQANSEDRHLVDQMPDSSDSPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPN
AGTVEQTPKKPGLRRQT
NT seq 594 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgagagtgtctaacgggagcccgagcctggagcggatggacgccagacaa
accgagcaccccaagccttccgcctgcagaaacctcttcggcccggtcaatcatgaagaa
ctaacccgggacttggagaagcactgccgagatatggaagaagcgagccagcgcaagtgg
aatttcgactttcagaatcataagcccctggagggcagatacgagtggcaggaggtggag
aggggcagcttgcccgagttctactacagacccccgcgcccccccaagagcgcctgcaag
gtgccggcgcaggagagcttggatgtcagcgggagccgccaggcggtgccttcaattggg
tctcaggcaaactctgaggaccggcatttggtggaccaaatgcctgactcgtcagacagt
ccggctgggttagcggagcagtgtccagggatgaggaagcgacctgcggcagaagattct
tcttcgcaaaacaaaagggccaacagaacagaagaaaatgtttcagacggttccccgaat
gctggcactgtggagcagacgcccaagaagcccggccttcgacgccagacgtaa

DBGET integrated database retrieval system