KEGG   Rattus norvegicus (rat): 84577Help
Entry
84577             CDS       T01003                                 

Gene name
Hdac2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04213  Longevity regulating pathway - multiple species
rno04330  Notch signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05016  Huntington disease
rno05034  Alcoholism
rno05165  Human papillomavirus infection
rno05169  Epstein-Barr virus infection
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05203  Viral carcinogenesis
rno05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    84577 (Hdac2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    84577 (Hdac2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    84577 (Hdac2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    84577 (Hdac2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    84577 (Hdac2)
   05202 Transcriptional misregulation in cancer
    84577 (Hdac2)
   05203 Viral carcinogenesis
    84577 (Hdac2)
  09162 Cancers: Specific types
   05220 Chronic myeloid leukemia
    84577 (Hdac2)
  09164 Neurodegenerative diseases
   05016 Huntington disease
    84577 (Hdac2)
  09165 Substance dependence
   05034 Alcoholism
    84577 (Hdac2)
  09172 Infectious diseases: Viral
   05169 Epstein-Barr virus infection
    84577 (Hdac2)
   05165 Human papillomavirus infection
    84577 (Hdac2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    84577 (Hdac2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     84577 (Hdac2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     84577 (Hdac2)
   HDAC complexes
    Sin3A-HDAC complex
     84577 (Hdac2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    84577 (Hdac2)
  Chromatin remodeling factors
   NuRD complex
    84577 (Hdac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 84577
NCBI-ProteinID: NP_445899
RGD: 619976
Ensembl: ENSRNOG00000000604
UniProt: F7ENH8 B1WBY8
LinkDB All DBs
Position
20q12
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAVLELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKEAEDKRTDVKEEDKSKDNSGEKTDTKGA
KSEQLNNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtgtgctactattatgacggtgatatc
gggaattattattacggccagggtcatcccatgaagccccataggatccggatgactcat
aacttgcttctaaattatggtttataccgaaaaatggaaatatataggcctcataaggcc
actgctgaagaaatgacaaaataccacagtgatgagtatatcaagtttctacgatcaata
aggccagataacatgtcagagtatagtaagcagatgcagagatttaatgtcggagaagac
tgtccagtgttcgatggactctttgagttttgtcagctctccaccggtggctcagttgct
ggggccgtgaagctgaaccgtcaacagactgacatggctgtcaactgggcgggaggactg
caccacgccaagaagtcagaggcctcaggattctgctacgttaatgacattgtgcttgct
gtcctcgagctactgaaatatcatcagagagtcttatatattgacatagacatccaccat
ggtgatggtgttgaggaagctttttatacaacagatcgcgtgatgaccgtctcattccat
aaatacggagaatactttcctggaacaggagacttgagggatattggtgctggaaaagga
aagtactacgctgtcaactttcccatgagggacggtatagatgacgagtcatatggacag
atatttaagcctataatctcaaaagtgatggagatgtaccagccgagcgcggtggtgctg
cagtgtggcgctgactccctctctggtgacaggctgggctgcttcaacctaactgtcaaa
ggtcacgctaaatgtgtagaagtagtgaaaacttttaacttgccgttgctgatgcttggc
ggaggtggctacacaatccggaatgttgctcgatgttggacgtatgagactgcagttgcc
cttgattgtgaaattcccaatgagttgccatataatgattacttcgagtattttggacca
gacttcaaactgcatattagtccctcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatctgcgaatgttaccacatgcgcctggtgtt
caaatgcaagctattccagaagatgctgttcatgaagacagtggtgatgaggatggagaa
gaccctgacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagag
ttctcagattctgaggatgaaggtgaaggaggtcgtaggaatgtcgctgatcataagaag
ggagccaaaaaagccaggattgaggaagacaagaaggaggcggaggacaagaggacagat
gttaaggaagaagacaaatccaaggacaatagtggtgagaaaacagacaccaaaggagcc
aaatcagaacaactcaacaacccttga

DBGET integrated database retrieval system