KEGG   Rattus norvegicus (rat): 85496Help
Entry
85496             CDS       T01003                                 

Gene name
Enpp1, Npps, Pc1
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 1
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00240  Pyrimidine metabolism
rno00500  Starch and sucrose metabolism
rno00740  Riboflavin metabolism
rno00760  Nicotinate and nicotinamide metabolism
rno00770  Pantothenate and CoA biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    85496 (Enpp1)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    85496 (Enpp1)
   00240 Pyrimidine metabolism
    85496 (Enpp1)
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    85496 (Enpp1)
   00760 Nicotinate and nicotinamide metabolism
    85496 (Enpp1)
   00770 Pantothenate and CoA biosynthesis
    85496 (Enpp1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    85496 (Enpp1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    85496 (Enpp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     85496 (Enpp1)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     85496 (Enpp1)
CD molecules [BR:rno04090]
 Proteins
  85496 (Enpp1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  85496 (Enpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 85496
NCBI-ProteinID: NP_445987
RGD: 628825
Ensembl: ENSRNOG00000013994
UniProt: Q924C3
LinkDB All DBs
Position
1p12
AA seq 906 aa AA seqDB search
MERDGEQAGQGPRHGPAGNGRELESPAAASLLAPMDLGEEPLEKAERARTAKDPNTYKVL
SLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFSNCRCDAACVSLGNCCLDFQE
TCVEPTHIWTCNKFRCGEKRLSRFVCSCADDCKAHNDCCINYSSVCQEKKSWVEEACETI
DAPQCPAEFESPPTLLFSLDGFRAEYLHTWGGLLPVISKLKNCGTYTKNMRPVYPTKTFP
NHYSIVTGLYPESHGIIDNKMYDPKMNASFSLKSKEKFNPLWYKGQPIWVTANHQEVRSG
TYFWPGSDVEIDGILPDIYKVYNGSVPFEERILAVLEWLQLPSYERPHFYTLYLEEPDSS
GHSHGPVSSEVIKALQKVDHIVGMLMDGLKDLGLDKCLNLILISDHGMEQGSCKKYVYLN
KYLGDVNNVKVVYGPAARLRPTEVPETYYSFNYEALAKNLSCRETNQHFRPYLKHFLPKR
LHFAKNDRIEPLTFYLDPQWQLALNPSERKYCGSGFHGSDNLFSNMQALFIGYGPAFKHG
AEVDSFENIEVYNLMCDLLGLIPAPNNESHGSLNHLLKKPIYTPSHPKEESFLSQCPIKS
VSSDLGCTCDPSIVPIMDFEKQFNLTTDAVEDVYSMTVPNGRPRNLQKQHRVCLLHQQQF
LTGYSLDLLMPLWTSYTFLSNDQFSTDDFSNCLYQDLRIPLSPMHKCSYYKSTSKLSYGF
LTPPRLNRVSRQIYSEALLTSNIVPMYQSFQVIWQYLHDTVLRRYAQERNGVNVVSGPVF
DFDYDGRYDSSEILKQNTRVIRSQENLIPTHFFIVLTSCKQLSESPLKCTALESSAFLLP
HRPDNIESCTHGKQESAWVEELLALHRARVTDVELITGLSFYQDRQESVSELLRLKTHLP
IFSQED
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgacggcgaacaggcagggcaagggccccggcatgggccagcgggaaacggc
cgcgagctggagtctccagccgccgcttcgctgctggcgcccatggacctaggggaggag
ccgctggagaaggcggagcgtgcgcgcaccgccaaagaccccaacacctacaaagtgctg
tcgctggttttgtcagtatgcgtgctaacaactattcttggttgtatctttgggttgaaa
ccaagctgtgccaaagaagtgaaaagttgcaaaggccgctgctttgaaaggacgttcagc
aattgtcgctgcgatgctgcctgtgtcagccttgggaactgctgtctggatttccaagag
acctgtgtggaaccaacacatatatggacttgcaacaagttcaggtgcggcgagaagagg
ctgtccagatttgtgtgctcctgtgcggacgactgcaaagcccacaatgactgttgcatc
aactacagttcagtgtgccaagaaaagaagagttgggtagaagaagcctgcgaaaccatc
gatgcaccacagtgtccagcagagtttgaatcaccccctactctcttgttttctttggat
ggattcagagctgaatatttgcacacttggggtggacttcttcctgtcattagcaagctg
aaaaactgtggaacgtacactaaaaacatgaggcctgtgtaccctaccaagacgtttccc
aatcattacagcatcgtcacaggactttatccagaatcacatggcataattgacaacaag
atgtatgatcctaaaatgaacgcttctttctcacttaaaagtaaagagaaattcaaccct
ctgtggtacaaaggacagccgatctgggtgaccgctaatcatcaggaggtcaggtctggc
acatacttctggccaggatcagacgtggaaattgatgggattctgccagatatctacaaa
gtgtataatgggtcagtaccatttgaagaaaggattttagctgttctcgagtggctacag
cttcctagctatgaaagaccacacttttacactctgtatttagaagaaccagattcttca
gggcattcacacggaccagtaagcagtgaggtcatcaaggccctgcagaaggttgaccac
atagttggcatgctgatggatggcctgaaggacctgggcttggataaatgcctgaacctc
atcctcatttcagatcacggcatggaacaaggcagttgtaagaagtacgtgtacctgaat
aagtacctgggggatgtgaacaatgtcaaggttgtgtatggacctgctgctcgattgaga
cccaccgaggttccggagacatactattcgtttaactatgaagcccttgcaaaaaatctt
tcttgccgggaaacaaaccagcacttccggccttatctgaaacacttcttacccaagcgc
ttacactttgctaaaaatgacaggattgagccactgaccttctatctggaccctcaatgg
caacttgccttgaatccgtcagaaaggaaatattgtggaagtggatttcatggctctgac
aacctgttttcaaacatgcaagctctcttcattggctatggacctgccttcaagcacggt
gctgaggttgactcctttgaaaatatcgaggtctataacttaatgtgtgatttattgggt
ttgatcccagctcctaataatgaaagtcacggcagtctcaaccatcttctaaagaaaccc
atttataccccaagtcatcccaaagaagagagcttcctgtcccagtgtccaatcaaatca
gtgtccagtgacctcggctgcacatgtgacccttcgattgtgccgatcatggacttcgag
aagcagttcaatctgaccaccgatgctgtagaggatgtttactctatgactgtgcccaac
ggaaggccccggaatctgcagaagcagcaccgcgtctgtctgctccatcagcaacagttt
ttgactgggtacagcctggacctcctcatgcccctgtggacgtcttacacctttctcagt
aatgaccagttctccacagatgacttttccaactgtttgtaccaggaccttcggattccc
cttagtcccatgcataaatgttcctattataaaagcacttctaagctcagttatgggttc
cttacaccgccaagactaaacagagtctcacgtcaaatatattctgaagccttgcttact
tctaacatagtgccaatgtaccagagttttcaagttatatggcaataccttcatgacacc
gtactgcgaaggtatgcccaagaaaggaatggcgtcaatgttgtcagcggccccgtgttc
gactttgattatgatggacggtatgattcctcagagatcctgaaacaaaacaccagagtc
atccgcagtcaagaaaatctgattcccactcacttcttcattgtgcttaccagctgcaag
cagctgtctgagagccccttaaagtgtacagccttagagtcttcagccttcctcttgcct
cacaggcctgataacatcgagagctgtacacatggaaagcaggagtctgcatgggttgaa
gagttgctggcattgcacagagctcgggtcacagacgttgagctcatcacgggtctcagc
ttctaccaggaccgacaggagtcagtttcagaactgctgaggttgaaaacacacttacca
atcttcagccaagaagactga

DBGET integrated database retrieval system