KEGG   Rhodococcus opacus PD630: Pd630_LPD00002
Entry
Pd630_LPD00002    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III subunit beta
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD00002
   03430 Mismatch repair
    Pd630_LPD00002
   03440 Homologous recombination
    Pd630_LPD00002
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00002
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00002
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD00002
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD00002
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD00002
SSDB
Motif
Pfam: DNA_pol3_beta DNA_pol3_beta_2 DNA_pol3_beta_3
Other DBs
NCBI-ProteinID: AHK27253
LinkDB
Position
2635..3876
AA seq 413 aa
MVTGRPWRTTVPTERNNPAMELGSLKFRVSREEFADSVAWVARSLPSRPPVPVLGGVLLD
ATEQGLTVSGFDYEVSAQVRVAAEVGSAGQVLVSGKLLADITKSLPNKPVDVTLEGTRVL
ITCGSAKFSLPTMPVEDYPQLPQLPQQTGSIPADVFSEAISQVAVAAGKDDTLPMLTGIR
VEIERNAIVLAATDRFRLAVRELEWSPANPDTTAAVLIPAKTLSESAKTLAGDATSPVEL
ALGSGSAVGNDGLLGIVNDGRRTTTRLLDAEFPKFRQLLPSEHTALATVEIAPLVEAIKR
VALVAERGAQVRLQFSTEGLLLSAGGDDAGRAEEGLNAVFQGEPLTIAFNPGYLIDGLSS
LHSEQVLFGFTTPSRPAVLRPATEDEIEPDDSGNFAAPESAYTYLLMPVRLPG
NT seq 1242 nt   +upstreamnt  +downstreamnt
gtggtcacgggccgaccgtggcgaacaacggtgcctaccgagaggaacaacccggcgatg
gagcttggaagcctgaagtttcgtgtctcccgggaagaattcgctgattcagtggcatgg
gtcgctcgcagtctgccgtcgcggcctcctgtccccgttctcggcggtgttctcctggac
gcgaccgagcaagggttgacggtttccggattcgactacgaggtatcggcccaggtcagg
gtcgcagccgaggtcggtagcgccggtcaggtcctcgtctccggcaagcttctcgccgac
atcacgaagtcgctccccaacaagccggtcgacgtgaccctcgaaggcacccgcgtactg
atcacgtgcggaagcgccaagttctccctgcccaccatgccggtcgaggactatccccag
cttccgcagctgccgcagcagaccggctcgattcccgccgacgtcttctccgaagcgatc
agtcaggtggctgtcgcggcgggcaaggacgacaccctgccgatgctcaccggcatccgg
gtcgagatcgaacgcaacgcgatcgtgctcgccgccaccgaccggttccgtctcgcggtc
cgtgaactcgagtggtcgccggcgaaccccgacaccaccgcggccgtcctcatccccgcc
aagacgctctccgagtcggcgaaaacgcttgcaggagatgccacttcgccggtggagctc
gcgctcggttcgggctccgcggtcggcaacgacggcctcctcggcatcgtcaacgacggc
cgccgcaccaccacccggctgctggacgccgagttcccgaagttccggcagctgctgccg
tccgagcacaccgcgctggccaccgtcgagatcgctccgctcgtcgaggccatcaagcgt
gtggccctcgtcgccgagcgcggtgcgcaggtccgcctgcagttctccaccgaggggctt
ctcctctccgccggtggcgacgacgcaggtcgcgccgaggaaggcttgaacgcggtgttc
cagggtgagccgctcaccatcgccttcaatcccggctacctgatcgacggactgtcttcg
ttgcacagcgagcaggtgctgttcggtttcacgacccccagccgccccgcggtgctgcgt
ccggccaccgaggacgagatcgaacccgacgattccggcaacttcgcggcgccggagagc
gcgtacacgtacctgctgatgccggtgcgtctcccgggctga

KEGG   Rhodococcus opacus PD630: Pd630_LPD00599
Entry
Pd630_LPD00599    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD00599
   03430 Mismatch repair
    Pd630_LPD00599
   03440 Homologous recombination
    Pd630_LPD00599
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00599
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00599
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD00599
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD00599
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD00599
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA AAA_22 RuvB_N AAA_16 Rad17 AAA_30 Mg_chelatase AAA_19 AAA_14 Herpes_Helicase TsaE AAA_18
Other DBs
NCBI-ProteinID: AHK27837
LinkDB
Position
590231..591295
AA seq 354 aa
MALYRKYRPASFAEVVGQEHVTEPLSTALDAGRINHAYLFSGPRGCGKTSSARILARSLN
CVEGPTSTPCGQCPSCVALGPGGSGNLDVTELDAASHGGVDDTRELRDRAFYAPAESRYR
VFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSRTHHYPFRLLAPA
TMRGLLEKICHQESVPVADPVYPLVIRAGGGSPRDSLSILDQLLAGAGDEGVTYPRALAL
LGVTDVALIDDAVDALATGDGAALFGTVDRVMDAGHDPRRFAVDLLERLRDLILMQAVPD
AAERGLVDAPGDVLEHMRAQVQRIGPATLARYAEVMHAGLGEMRGARPPACCSK
NT seq 1065 nt   +upstreamnt  +downstreamnt
gtggccctgtaccggaagtaccgacccgcatccttcgccgaggtggtggggcaggagcac
gtcaccgaaccactgagcaccgctctcgacgccggacggatcaaccacgcgtatctgttc
tccggtccccgcggctgtggcaagacgtcgtctgcccgcatcctggcccgatcgctgaac
tgcgtcgagggtccgacctcgacgccgtgcggccagtgcccctcgtgcgtggcgctcggc
cccgggggatcgggcaacctcgacgtcaccgaactcgacgcggccagccacggtggcgtc
gacgacacccgtgagctgcgtgaccgcgcgttctacgcgcccgccgagtcgcggtaccgg
gtgttcatcgtggacgaggcccacatggtcaccacggccggtttcaacgcgctcctcaag
atcgtcgaggagccgccggagcacctcatcttcatcttcgccaccaccgaacccgagaag
gtgctgccgaccatccgttcgcgcacccaccactacccgttccggttgctcgcgccggcg
acgatgcgcgggttgctggagaagatctgccaccaggagagtgtgccggtcgccgacccg
gtgtatccgctggtcatccgcgcgggtggcggttcgccgcgtgactcgctgagcatcctc
gatcagctgctcgccggagcgggcgacgagggcgtcacctacccgcgcgcgctcgcgctg
ctcggcgtcaccgacgtcgcgctcatcgacgacgccgtggacgcgctcgccaccggcgac
ggtgcagcgctgttcgggacggtcgaccgcgtgatggacgccgggcacgatccgcgccgg
ttcgccgtcgacctgctcgagcgcctgcgcgatctcatcctgatgcaggcggtgcccgac
gccgccgaacgcggcctggtcgacgcgcccggcgacgtgctcgagcacatgcgcgcgcag
gtccagcggatcggtcccgccacgctcgcccgctacgccgaggtgatgcacgcaggcctc
ggtgagatgcgcggcgccaggccccccgcctgctgctcgaagtga

KEGG   Rhodococcus opacus PD630: Pd630_LPD00600
Entry
Pd630_LPD00600    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD00600
   03430 Mismatch repair
    Pd630_LPD00600
   03440 Homologous recombination
    Pd630_LPD00600
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00600
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00600
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD00600
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD00600
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD00600
SSDB
Other DBs
NCBI-ProteinID: AHK27839
LinkDB
Position
591307..592482
AA seq 391 aa
MLLPSASDAESAVLQRLERVERGLPPAGSAPAFDAAERPAAAPARAPQPPAEPEPEPKFQ
RPSMRQAAAATVPPPPEPEPEPMPRPVPEPAPTPVPEPEPQPEPTPVPEPTPAPEPAPVP
APEPTPAPASAPVSEPEPTPAPEPTPVLEPTPEPEPEPSLTPEVEAEPAASAGPDAAALR
ESWNSLREKVSQRNKILPAMLSAATVHDVQGNRLILAHPVPNLGARIASPHNAQVITEVL
AEMFGGTWEVEYQAGAPTAPPPPVAKAAAAPTKPAGAPRFSRPSQEKTAQRPPQQQSDTQ
RSDSGPGAGQARPSSEPDDDIPPPEAPDYPDDPGPIDYEASATTPPVSTPEDEEEMFAEA
AEPVDPATRRDPEDVAFELLKDMLGAKKLEG
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgctgccctcggcgtccgatgcggagtccgccgtgctgcagcgactcgaacgcgtc
gaacgcggacttccgcccgccgggtcggcgccggccttcgacgcggccgagcggcccgcg
gcggctcctgcgcgtgcgccgcaaccgcctgccgagccggaaccggaaccgaagttccag
cgaccgtccatgcggcaggccgcggcagccaccgtgcccccgccgcccgagccggaaccc
gaaccgatgccgcggccggttccggaacccgcgccgacacccgttcccgaaccggagccg
cagcccgagccgacgccggtccccgaaccgacgcccgcacccgagccggcccctgttccc
gcacccgagccgacccccgcgccggcgtccgctcccgtctcggaacccgagccgactcct
gcaccggaaccgactcccgtgctggaaccgactcccgaaccggaaccggagccgtcgctc
acccccgaggtggaggcggagcccgccgcatcggccggtccggatgctgccgcgctgcgc
gagtcctggaactcgctgcgcgagaaggtgagtcagcggaacaagattctgcccgccatg
ttgtcggccgcgacggtgcacgacgttcagggcaaccgcctgatcctggcgcaccccgtc
cccaacctgggcgctcgcatcgcgtcaccgcacaacgctcaggtgatcaccgaggtgctc
gccgagatgttcggcggcacctgggaagtggagtatcaggccggtgctccgacggcgccg
ccaccaccggtcgcgaaggccgctgcagcgccgacgaagccggcaggcgcaccgcgattc
tcccggcccagtcaggagaagaccgcgcagcgtccgccgcagcagcagtccgacacacag
cgctccgactcgggtccgggtgcgggccaggcacgtccgtcgtccgagccggacgacgac
attccgccgccggaggcacccgactaccccgatgatcccgggccgatcgactacgaggct
tcggcgaccacgccgcccgtctccacacccgaggacgaggaagagatgttcgcggaggcg
gcggaacccgtcgaccccgcgactcgccgcgacccggaagacgtggcgttcgaactgctg
aaggacatgctcggggccaagaagctcgagggctga

KEGG   Rhodococcus opacus PD630: Pd630_LPD00801
Entry
Pd630_LPD00801    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III subunit gamma/tau
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD00801
   03430 Mismatch repair
    Pd630_LPD00801
   03440 Homologous recombination
    Pd630_LPD00801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00801
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00801
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD00801
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD00801
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD00801
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA AAA_22 DNApol3-delta_C Mg_chelatase AAA_16 RuvB_N AAA_5 DUF2914 DNA_pol3_delta
Other DBs
NCBI-ProteinID: AHK28039
UniProt: W8GZA0
LinkDB
Position
814215..815429
AA seq 404 aa
MTVFDRLVGQEDVEVELTAAATAARRGVGAMGSTMTHSWLFTGPPGSGRSVAAQCFAAAL
QCTSDGVPGCGVCHACTTAMAGTHGDVRQVVPEGLSISVKEMRAIVQTAARRPSTGRWQI
VVVEDADRLTEGAANALLKVVEEPPDRTVFLLCAPSVDPQDISVTLRSRCRHVHLVTPSA
DSIAKVLRERDGLDPADAQLAASISGGHVGRARRLATDLNAKVRRKDALDLAVAALRPAT
AFAAAEELVRSADAEAKEMSAARDEQETEELRTALGAGGTGKGAAGALRGSAGVLKDLEK
RQKSRATRTGRDALDRALIDLAGLYRDALAVAWKSNAAANHPDMADRAADLASRTTPEGL
LKCIEAVLECREAITVNVKPQWAVDAMVATLGDAFREPFSHTRG
NT seq 1215 nt   +upstreamnt  +downstreamnt
gtgacggtattcgaccggttggtgggccaggaggacgtcgaggtcgagctgacggccgcg
gcgactgccgcccgtcgtggagtcggtgcgatgggctccacgatgacgcattcatggctc
ttcactggcccaccgggatcgggtcgatcggtggcggcgcagtgtttcgccgccgcactc
caatgcaccagcgacggcgttcccggctgcggcgtgtgccacgcctgcaccaccgcgatg
gccggtacccacggtgacgtccggcaggtcgtccccgagggcctgagcatcagcgtcaag
gaaatgcgcgccatcgtgcagacggcggcccgccggccgagcaccgggcgctggcagatc
gtggtcgtcgaggacgcggaccggctcaccgagggtgcggccaacgctctcctgaaagtg
gtggaggagccgccggaccgcaccgtgttcctgttgtgtgcgccctccgtcgacccgcag
gacatctccgtgacgctgcggtcgcgctgccggcacgtccatctcgtgaccccgtcggcc
gactccatcgccaaggtcctgcgcgagcgggacggcctggaccccgccgatgcgcaactg
gcggcctcgatcagcggcggtcacgtcgggcgagcccggcgtctggcgacggatctgaac
gccaaggtgcgtcgcaaggacgctctggatctcgctgtcgcggcactgcggcccgccacc
gcgttcgccgcggcggaggaactggtgcgttccgccgacgcggaggcgaaggaaatgagc
gcggccagggacgagcaggagaccgaggagttgcgcacggctctgggggcgggcggcact
ggtaagggagcggccggggccctccgaggctcggccggcgtgctgaaggatctcgagaag
cgccagaagtcccgggccactcgcacgggccgtgacgcactcgaccgtgcactgatcgat
ctggctggtctctaccgcgacgcgctcgccgtcgcatggaaatcgaacgcggccgcgaac
cacccggacatggcggatcgcgcggccgacctcgcctcgcgaacaaccccggaaggcctt
ctgaagtgcatcgaagccgtcctcgagtgccgagaggcgatcaccgtcaacgtcaagccg
cagtgggctgtcgatgccatggtggccactctcggcgacgcgttcagggagccgttttcg
catactcggggttga

KEGG   Rhodococcus opacus PD630: Pd630_LPD01029
Entry
Pd630_LPD01029    CDS       T03071                                 

Definition
(GenBank) putative ATP-dependent helicase dinG
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD01029
   03430 Mismatch repair
    Pd630_LPD01029
   03440 Homologous recombination
    Pd630_LPD01029
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD01029
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD01029
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD01029
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD01029
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD01029
SSDB
Motif
Pfam: RNase_T DUF5051 Optomotor-blind
Other DBs
NCBI-ProteinID: AHK28263
LinkDB
Position
complement(1043647..1044252)
AA seq 201 aa
MCPWRDAEFAVVDLETTGLDLVRDTIVSYGAVVVRHGRIVMAESVYGLVHPECDIRPEAV
AVHTLREADVADAPPLGEAVGVLRHLLTDRVLVAHAAWVETAFLSRAFRDSGLKFRPTVV
DTAALARAVGVAPRQHRCEPNLEWLADTLGLPVVDPHHALGDAVTTAQVFLALATRLEHL
GHDTARSLVDLSAGDRRLGRG
NT seq 606 nt   +upstreamnt  +downstreamnt
gtgtgcccgtggcgcgacgccgagttcgcggtcgtcgatctggagaccaccggactggat
ctcgtgcgggacaccatcgtgtcctacggggccgtcgtggtccggcacggtcgcatcgtc
atggcggagagtgtctacggactggtccaccccgagtgcgacattcgcccggaggccgtg
gccgtccacactctccgggaggcggacgtcgccgatgccccaccgttgggcgaggccgtc
ggcgtcctgcgacatctcctcaccgaccgtgtcctcgtcgcccacgcggcgtgggtcgag
acggccttcctctcccgcgcctttcgcgacagcgggctgaagttccggccgacggtcgtg
gacaccgctgccctcgcccgtgctgtcggcgtggcgccgcgacagcaccggtgcgagccg
aacctggaatggctggctgacacgctcggcctgcccgtcgtcgatccccaccacgcactg
ggcgacgccgtcaccacggcacaggtgttcctcgccctggcgacccggctcgagcacctc
gggcacgacaccgcgcgctccctcgtggatctgagtgccggcgaccgtcgcctcgggcgc
ggttga

KEGG   Rhodococcus opacus PD630: Pd630_LPD01623
Entry
Pd630_LPD01623    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III polC-type
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD01623
   03430 Mismatch repair
    Pd630_LPD01623
   03440 Homologous recombination
    Pd630_LPD01623
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD01623
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD01623
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD01623
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD01623
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD01623
SSDB
Motif
Pfam: RNase_T DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AHK28852
LinkDB
Position
complement(1710286..1710981)
AA seq 231 aa
MTSWSDRPICAFDLETTGPDPTDARIVSACIAVVDAHHFESRTWLLDPEVPIPQGASDVH
GISTEYARSHGQDYATGYGEIREALHDAWTRDHAVVAFNASYDLTVMHTEGLRLGLTELV
TGIVVDPYVIDREMDRYRKGRRTLGAVCEHYGIALEDAHEAEADAIAAAHLARTLAQEYP
NLRALDIMSHQAGWHAERQRDFADYLVRQGRDASDVNGEWPIRGLPRFRIA
NT seq 696 nt   +upstreamnt  +downstreamnt
atgaccagctggtcggacagaccgatctgcgcgttcgacctggagacgacgggacccgac
cccaccgacgcccgcatcgtctccgcgtgcatcgccgtcgtcgacgctcaccacttcgag
tcgcgaacctggctgctcgacccggaggttcccatcccgcagggcgcctcggacgtgcac
ggaatctccacggagtacgcccggtcccacggacaggactacgccaccgggtacggcgag
atccgcgaggctctgcacgacgcgtggacccgcgaccatgccgtcgtcgcgttcaacgcc
tcctacgacctgaccgtcatgcacaccgagggcctgcgcctcgggctgaccgaactcgtc
accggcatcgtggtcgatccctacgtcatcgaccgcgagatggaccggtatcggaagggc
aggcgcactctcggcgcggtgtgcgagcactacggcatcgcgctggaggacgcccacgag
gccgaggccgacgcgatcgccgccgcgcacctcgcccggacgctcgcgcaggagtatccg
aatctgcgggccctggacatcatgagccatcaggccggctggcacgcggaacggcaacgc
gacttcgccgactacctcgtccggcagggccgtgacgcatcggacgtcaacggcgagtgg
ccgattcgcggtctcccccggttccgcatcgcctga

KEGG   Rhodococcus opacus PD630: Pd630_LPD05163
Entry
Pd630_LPD05163    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III subunit alpha
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05163
   03430 Mismatch repair
    Pd630_LPD05163
   03440 Homologous recombination
    Pd630_LPD05163
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05163
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05163
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05163
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD05163
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD05163
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon
Other DBs
NCBI-ProteinID: AHK32369
UniProt: W8HBP5
LinkDB
Position
complement(5345474..5349010)
AA seq 1178 aa
MADSFVHLHNHTEYSMLDGAAKVGPLFEEAERLGMSAVGMTDHGNMYGASEFYNVAKKQG
IKPIIGIEAYIAPESRFNTKRVLWGDRSQKSDDVSGSGAYTHMTMVAENATGLRNLFKLS
SLASIEGQLGKWARMDEELIATHHEGIIATTGCPSGEIQTRLRLGHDREALEAAAKWQEI
WGKDNFFLELMDHGLSIERRVREGLLEISKKLEIPPLATNDCHYVTKEAAENHEALLCIQ
TGKTLSDPTRFKFDGDGYYLKPAAEMRALWDDQVPGACDNTLLIAERVQSYDDVWAHHDR
MPIFPVPEGETQGTWLRKEVMRGLDRRFPDGPPEEYLARADYEIGVILEMGFPAYFLVVG
DLINHAREVGIRVGPGRGSAAGSLVAYAMGITNIDPIPHGLLFERFLNPERVSMPDIDID
FDDRRRGEMVRYATDKWGSDRVAQVITFGTIKTKAAIKDSARVQFGQPGFAIADQITKAL
PPPIMAKDISVSGITDPNHERYKEAVEVRALIDSNPDVAKIYQTAKGLEGLIRNAGVHAC
AVIMSSEPLMDAIPVWRRAQDGAIITGWDYPSCEAIGLLKMDFLGLRNLTVIGDAIDNIK
ANRGIDLDLDTLALDDPATYELLSRGDTLGVFQLDGSAMRDLLRRMQPTGFEDIVAVLAL
YRPGPMGMNAHNDYADRKNGRQEVKPIHPELEEPLKEILADTYGLIVYQEQIMQIAQKVA
GYSLGQADILRRAMGKKKLSVLEEAYAGFREGMLANEFSEPAIKALWDTILPFAGYAFNK
SHAAGYGLVSFWTGYLKANYPAEYMAGLLTSVGDDKDKAAIYLADCRKMGITVLPPDVNE
SEVNFASVGEDIRFGMGAVRNVGANVVGSIIKARKEKSKFVDFSDYLNKIDAAACSKKVT
ESLIKAGGFDSLGHPRKGLMLVHADAIDAVMGTKKAEAIGQFDLFGGDDADESISSVFNV
KIPEEEWDSKHRLALEREMLGLYVSGHPLNGVEHVLSAQSDTAIPTILEGDIKDGTQVTV
GGILASVNRRINKNGLTWASAQLEDLTGGIEVLFFPQAYSVYGMDVTDDSVVLVKARVSI
RDDRISLIANDLAVPDLSAVGVAKPLAVSLPLRQCTKDKIGALRQVLTRHPGTSDVHVRL
IGGTEVTLWKVDDVLRVEPSSALMGDLKALLGPSCLSV
NT seq 3537 nt   +upstreamnt  +downstreamnt
gtggctgactcgttcgtacatctgcacaatcacaccgagtactcgatgctcgacggtgcg
gccaaggtcggccccctgttcgaagaggccgagcgactggggatgtcggcggtcggcatg
accgaccacggcaacatgtacggcgccagcgagttctacaacgtcgcgaagaagcagggc
atcaagccgatcatcggcatcgaggcgtacatcgcgcccgagtcccgcttcaacaccaag
cgcgtgctgtggggcgaccgcagccagaagtccgacgacgtctccggtagcggtgcgtac
acccacatgacgatggtcgcggagaacgcgaccggtctgcggaacctgttcaagctgtcc
tcgctcgcgtcgatcgagggtcagctcggcaagtgggcgcggatggacgaagagctcatc
gccacccaccacgagggcatcatcgcgaccacgggctgcccgtccggtgagatccagacc
cggctgcgactcggccacgaccgagaggcgctcgaggccgccgccaagtggcaggagatc
tggggcaaggacaacttcttcctcgagctgatggaccacggactctcgatcgagcgacgg
gtgcgcgagggcctgctcgagatcagcaagaagctcgagattccgccgctcgccaccaac
gactgccactacgtcaccaaggaagccgcggagaaccacgaggcgcttctctgcatccag
accggtaagacgctgtccgaccccacccggttcaagttcgacggcgacggctactacctg
aagccggccgcggagatgcgggcgctgtgggacgaccaggtgcccggcgcgtgcgacaac
acactgctgatcgccgagcgggtccagtcgtacgacgacgtctgggcgcaccacgaccgg
atgccgatcttcccggtccccgagggtgagacgcagggcacctggttgcgcaaggaggtc
atgcgcggactggatcgccggttccccgacggaccccccgaggagtacctcgcccgcgcc
gactacgagatcggcgtcatcctcgaaatgggtttccccgcctacttcctcgtcgtcggt
gacctcatcaaccacgcccgggaggtcggcatccgcgtcggccccggccgaggctcggcg
gccggttcgctcgtcgcctacgcgatgggcatcaccaacatcgaccccatcccgcacggt
ctgctgttcgagcggttcctgaaccccgaacgcgtctccatgcccgatatcgatatcgac
ttcgacgatcgccgtcgcggcgagatggtgcgctacgcgacggacaagtggggcagcgac
cgcgtcgcccaggtcatcacgttcggcaccatcaagacgaaggcggccatcaaggactcc
gcccgagtccagttcggccagcccggtttcgcgatcgccgaccagatcacgaaggcgctg
ccgccgccgatcatggccaaggacatctcggtgtccggcatcacggacccgaaccacgag
cgctacaaggaagcggtggaggttcgcgccctcatcgactccaacccggacgtcgcgaag
atctaccagacggccaaggggctcgagggcctgatccgtaacgccggcgttcacgcctgc
gcggtgatcatgtcgtccgaaccgctgatggacgcgattcccgtgtggaggcgcgcccag
gacggtgccatcatcaccggctgggactacccgtcgtgcgaggccatcggcctgctgaag
atggacttcctcggactgcggaacctcaccgtcatcggtgacgccatcgacaacatcaag
gcgaaccgggggatcgacctcgatctcgacaccctcgcgctcgacgacccggccacgtac
gaactgctctcccgcggagacactctcggcgtgttccagctcgacggcagcgcgatgcgc
gacctgctgcgccgcatgcagcccaccggcttcgaagacatcgtcgcggtgctcgcgctg
taccggcccggtccgatgggcatgaacgcgcacaacgactacgccgaccgcaagaacggg
cggcaagaggtcaaacccatccacccggagctcgaggagcccctgaaggagatcctggcc
gacacgtacggcctgatcgtctaccaggagcagatcatgcagatcgctcagaaggtggcc
gggtattcgctcggacaggccgacattctccgccgagccatgggtaagaagaagctctcg
gtgctggaggaggcgtatgccggcttccgcgagggcatgctcgccaacgaattctccgag
cccgccatcaaggcgctgtgggacaccatcctcccgttcgccgggtacgcgttcaacaag
tcgcacgcggccgggtacggcctggtgtcgttctggaccgggtatctcaaggccaactac
ccggccgagtacatggccggtctgctcacctcggtcggtgacgacaaggacaaggccgcc
atctacctcgcggactgccgcaagatgggtatcaccgtgctgccgccggacgtcaacgaa
tcggaggtcaacttcgcctccgtcggtgaggacatccggttcggcatgggcgccgtccgc
aacgtcggcgccaacgtcgtgggctcgatcatcaaggcgcgcaaggagaagtccaagttc
gtcgacttctccgactacctcaacaagatcgacgccgccgcctgctccaagaaggtcacc
gaatcgctgatcaaggcaggcgggttcgactcgctgggccatccgcgcaagggactcatg
ctcgtccacgccgacgccatcgacgcggtgatgggcaccaagaaggcggaggcgatcgga
cagttcgacctcttcggcggcgacgacgccgacgagtcgatctcctcggtgttcaacgtg
aagatccccgaggaagagtgggactcgaagcaccggttggcgctggaacgggaaatgctg
ggactgtacgtgtccgggcacccgctcaacggcgtcgaacacgtgctgtcggcgcagtcc
gacaccgcgataccgaccatcctcgaaggcgacatcaaggacggcacccaggtcaccgtc
ggcgggatcctcgcgtcggtgaaccggaggatcaacaagaacggtctcacctgggcgtcc
gcgcagctcgaggatctgaccggtggtatcgaggtgctgttcttcccgcaggcctactcg
gtctacgggatggatgtcacggacgactccgtcgtgctcgtcaaggcgcgagtgtcgatt
cgtgacgatcggatctcactcatcgccaacgaccttgcggtgccggatctctcggcagtg
ggggtcgcgaagccgctggcggtcagtctgccgctgcgtcagtgcaccaaggacaagatc
ggcgcgttgcgtcaggtgctcacgcgccatccgggcacgtcggacgtccacgtgcggttg
atcggcggcaccgaggtcaccttgtggaaggtcgacgacgtgctccgggtggaaccgtcg
tcggcgttgatgggcgatctcaaggcgctgctcggaccgagctgcctgtccgtgtga

KEGG   Rhodococcus opacus PD630: Pd630_LPD05222
Entry
Pd630_LPD05222    CDS       T03071                                 

Definition
(GenBank) Uncharacterized protein
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05222
   03430 Mismatch repair
    Pd630_LPD05222
   03440 Homologous recombination
    Pd630_LPD05222
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05222
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05222
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05222
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD05222
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD05222
SSDB
Motif
Pfam: RNase_T DUF5051 GIY-YIG RNase_H_2
Other DBs
NCBI-ProteinID: AHK32428
LinkDB
Position
5410921..5412687
AA seq 588 aa
MSAPGVPEQLRFDELDTPLRDTTFVVVDLETTGARPGEDAITEIGAVKIRGGEVIAEMAT
LVDPGRSIPPHIVEITGITTAMVIDAPRIERVLPAFLEFARGAVLIAHNAPFDTGFLKAA
ASATDTPWPKFTVLCTVKLARRVLSRDEAPSVKLSSLARLFDVGTTPTHRALDDARATVD
VLHALIARVGNQGVHSLTELVDYLPDVSSHQRAKRSLAGHLPHAPGVYLFRGPSDEVLYV
GTATDLRRRVRNYFTGSETRGRMKEMVALTTRIDHVECAHALEAGVRELRLLAAHTPPYN
RRSKYPKRGWWITLTAEAFPRLSVARTPTADSLGPFRSRSTAVDVADVLAEYCILRTCTS
RIPKGREHGPQCPPRELGRCPASVHDRVTEDAYRPGPELFRQFLRGLDDSPLHRMRARVE
ELAAGELFENAARLRDRTAEVVLALRRMQRLAALTALDQLVAARPAVTGGWEFAVIRSGR
LASAGCARRGIHPMPVVDALVLTAETVVPDATPLRGASPEEAGLLARWLDQEDTRIVSAS
AGWCEPARGAGSWSEWCALARAGSASTREAETRPPAPSSADHRLGWRS
NT seq 1767 nt   +upstreamnt  +downstreamnt
gtgagtgcccccggtgtacccgaacagctgagattcgacgagctcgacaccccactgcgg
gacaccacgttcgtggtggtcgatctcgagaccaccggcgcacggccgggcgaggacgcc
atcaccgagatcggcgccgtgaagatccgcggcggcgaggtgatcgccgaaatggccact
ctcgtcgacccgggacggtccatcccgccgcacatcgtggagatcaccggcatcaccacc
gccatggtgatcgacgccccgcggatcgagcgagtgctgccggcgttcctggagttcgca
cgcggggccgtgctcatcgcccacaacgccccgttcgacacgggcttcctcaaggccgcg
gcgtccgccaccgacaccccctggcccaagttcaccgtgctctgcaccgtcaaactggcc
cggcgcgtcctcagccgcgacgaagcgccgtccgtcaagctgtcgtcgctggcccggctg
ttcgacgtcgggaccactccgacccaccgggcgctcgacgacgcccgtgccaccgtcgac
gtcctgcacgccctcatcgcgagggtcggcaatcagggagtgcacagtctcaccgaactc
gtcgactacctgcccgacgtctcctcacaccagcgggcgaaacgctcactcgccggccat
ctcccccacgcccccggcgtctacctgttccgcggaccgtccgacgaggtcctctacgtc
ggcacggcgaccgatctgcgccggcgggtgcgcaactacttcaccggctccgagacgcgc
ggccggatgaaggagatggtggccctgaccacccggatcgaccatgtcgagtgcgcgcat
gcgctcgaggccggtgtgcgcgagctccggctgctcgccgcgcatacgccgccgtacaac
cggaggtccaagtacccgaaacgcggctggtggatcacgctcaccgcggaggccttcccc
cggctgtcggtggcgcgtaccccgaccgccgactcgctcggtccgttccggtcccgctcg
accgccgtcgacgtcgccgacgtcctcgccgagtactgcattctccgcacctgcacgagc
cgcatcccgaagggaagggagcacggtccgcagtgcccgccccgcgagctcggacgctgc
ccggcgtccgtccacgaccgcgtcacggaggacgcctaccgtcccgggccggaactcttc
cggcagttcctgcgcggcctggacgactccccgctgcaccgcatgcgcgcacgggtggag
gagctggccgccggcgagttgttcgagaacgccgcacgcctgcgtgatcgcaccgcggag
gtcgtcctcgcgttgcgcagaatgcagcgcctggccgccctcaccgccctcgatcagctc
gtggccgctcgcccggccgtcaccggcggctgggagttcgcggtgatccgttccgggcga
ctcgcgtccgcgggctgcgcccggcgcggaatccatccgatgccggtggtcgatgcgctc
gtcctcaccgccgaaaccgtcgttcccgacgcaactccgcttcgcggcgcgtcccccgag
gaggccggactgctggcgcgctggctcgaccaggaggacacccgcatcgtcagcgcctcc
gcgggctggtgcgagcccgcgcggggcgccggatcctggtccgagtggtgcgcactcgcc
cgagcggggagcgcgtcgacacgggaagccgagacccgaccacccgcgccgagttccgcc
gaccaccgcttaggctggcgatcatga

KEGG   Rhodococcus opacus PD630: Pd630_LPD05387
Entry
Pd630_LPD05387    CDS       T03071                                 

Definition
(GenBank) hypothetical protein
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05387
   03430 Mismatch repair
    Pd630_LPD05387
   03440 Homologous recombination
    Pd630_LPD05387
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05387
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05387
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05387
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD05387
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD05387
SSDB
Motif
Pfam: DNA_pol3_delta DNA_pol3_gamma3
Other DBs
NCBI-ProteinID: AHK32590
LinkDB
Position
complement(5566913..5567890)
AA seq 325 aa
MSTPTQLEQLHLVLGDEEFLVERAVAQVIGHVRANADVAAGAELPVNRLRAGDAGAAELA
ELLSPSLFAEDRVVVLEAAAEAGKDAVALILDAAGDPPPGVVLVVLHSGGGRAKAMTGAL
EKLGAVVHPCAKLKSGDLIGFIRGEFRTLGVRVSPEVVQSVFEGVGSNLRELAAACSQLT
ADTGGKIDVAAVQRYYSGKAEVSGFDVADKAVAGDTAGAIEALRWAMLRGVPHVLLADAL
ADAVHSIARVAPAGRGDPFRMASELGMPPWKIKKAQALAKGWTPTSVGEALRIVAALNAD
VKGASADADYAVESAVGRVSRLRQV
NT seq 978 nt   +upstreamnt  +downstreamnt
gtgagcactccaactcagctcgaacagctccatctggtcctcggtgacgaggaattcctc
gtcgaacgcgcggtggcgcaggtcatcggccacgtccgcgcgaacgcggacgtggccgcg
ggcgcggagcttcccgtcaaccggttgcgggcgggcgatgccggggcggccgaactcgcc
gaactgctcagcccctcgctgttcgccgaagaccgcgtggtggtgctggaggccgccgcc
gaggcgggcaaggacgccgtggcactgatcctcgacgcggccggcgacccgccgcccggc
gtcgtcctggtggtcctgcactcgggtggcggacgtgcgaaagcaatgaccggggcgctg
gagaaactcggagctgtggtgcacccctgcgccaaactgaagtcgggcgacctcatcggg
ttcattcgcggcgagttccgcaccctcggggtccgggtgtcgccggaagtggtgcagagc
gtgttcgaaggagtcggctcgaatctgcgcgaactggccgccgcgtgctcgcagctgacg
gccgacaccggcgggaagatcgacgtcgccgccgtgcagcggtactactcgggcaaggcc
gaggtgagcggattcgacgtcgcggacaaggccgtcgccggtgacaccgcgggcgcgatc
gaggcgctgcgctgggcgatgctgcgtggcgtgccgcacgtgttgctggctgacgcgctg
gccgacgcggtgcactcgatcgcccgggtggccccggcggggcggggagacccgttccgg
atggcgtcggaactcgggatgccgccgtggaagatcaagaaggcacaggccctcgcgaag
ggatggactcccacatcggtgggggaggcgctgcgtatcgtggccgccctgaacgccgac
gtcaagggcgcgtcggccgacgcggactacgccgtcgagagtgcggtgggccgcgtctcc
cggctacgacaggtctga

KEGG   Rhodococcus opacus PD630: Pd630_LPD05998
Entry
Pd630_LPD05998    CDS       T03071                                 

Definition
(GenBank) Tellurium resistance protein TerD
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD05998
   03430 Mismatch repair
    Pd630_LPD05998
   03440 Homologous recombination
    Pd630_LPD05998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD05998
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD05998
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD05998
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD05998
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD05998
SSDB
Motif
Pfam: TerD RNase_T BRCT PTCB-BRCT DNA_pol_A_exo1 PGM_PMM_I
Other DBs
NCBI-ProteinID: AHK33189
LinkDB
Position
complement(6218925..6220655)
AA seq 576 aa
MDVETSGLRSSTHRVLSVAALALREDGSVERELVTLLNPGCDPGPVHIHNLTPQRLAGAP
RFEDVAKDLLELLDGRTLVAHNASFDYGFLDAEARRAGMTMPTRQRLCTLALSRRLEIDV
PNHKLSTLAAHWKVRQHRAHDAYDDALVLTEVFAHSASLAESLRLPLPVVGCADRRAVYP
DRVPRVESPWRNPGRLDPGAGLVQGMKLVISGSTDVPRLALAARLTAAGLDVMNSVSRQT
SVVVCNDPHSSSAKVRRAVADGIPVLTERQLGEMLLHVTPGEPKGAAAPSEVQRPRPATT
VPSTKPWHGRRVLIVGGSHADSVLMRSRIVQLGAKPSVNLSAGVTDVLVLDGGELDPRMD
RVSARQLPLLTAPDVNSALEPAAPPERGALREPIRPPSQWVAPLLARGEVIDLPPQTTSL
TVNASWRAHTEDDAFDVDVVALLLGEDGRVGCDEDFLFYNSPTSSDGTVELSCDGSSEQG
VRIELAALHSDYQCVSVSAAIGGDRAFGELGPISVTVDAPDRTIASFVLDAGTTERTMHF
AEIYRRAGQWRLRAVGQGYEYDLATLATEYGVTVDD
NT seq 1731 nt   +upstreamnt  +downstreamnt
gtggacgtcgagacctccggtcttcgttcgtccacgcacagagtgctcagcgtcgcggcg
ttggcgttgcgtgaagacggttcggtggagcgtgaattggtgactctgctcaacccgggc
tgcgacccggggccggtccatatccacaatctcacgccacagcgtctggcgggggcgccc
cgtttcgaagacgtcgcgaaagatctgctcgagcttctcgacggtcggacgctggtcgcg
cacaacgcgtcattcgattacggcttcctcgacgccgaggcacggcgggcggggatgacg
atgccgacacggcagaggctctgcaccctcgccctgtcgcgccgcctcgagatcgacgtc
cccaatcacaagttgtccactctggccgcgcactggaaggttcgtcagcaccgggctcac
gacgcttacgacgacgccctcgtgctgacggaggtcttcgcgcacagcgcctcgctggcc
gagtctctcagacttcctctgccggtcgtcggttgcgccgatcggcgggcggtgtacccc
gatcgggttccgcgcgtggagtctccgtggcggaatccgggtcggctggatccgggggcg
ggactggtccagggcatgaaactggtcatcagcggcagtacggatgttccccgtcttgcg
ctcgccgcacggttgaccgccgccggcctggacgtcatgaattcggtcagccgtcagacg
agtgtcgtcgtctgcaacgacccgcactcgtcgagtgcaaaggtgcgccgcgcggtggcc
gacgggattcctgtcctgaccgagcggcagctcggcgagatgttgctgcacgtgacaccg
ggtgagccgaagggggccgcggcaccgtccgaagttcagcggcctcgacctgcgacaact
gttccctccacgaagccttggcacggaagaagggtgctcatcgtcggtggctcgcatgcg
gactccgttctgatgcgctcccgcatcgtgcagctgggtgccaagccgtcggtcaatctc
tccgcaggagtcaccgatgtcctcgttctcgacggtggtgaactcgatccccgcatggac
cgagtgtcggcccgtcagttgcctctgctcaccgcccccgatgtgaactccgcactcgaa
ccggcggcaccacccgagcggggggcgctccgcgagccgatccgaccgccttctcagtgg
gttgcgccgttgctcgctcgcggtgaggtgatcgacctgccaccacagacgacatcgctg
acggtcaacgcgtcttggcgcgcccacaccgaggacgatgcgttcgacgtggatgtggtt
gcgcttcttctcggcgaagacggccgggtcggttgcgacgaggacttcctcttctacaac
tcgccgacgagttcggacggcaccgtggaattgtcctgcgacggcagcagcgagcaagga
gtgcggatcgaactggctgccctgcactccgactaccagtgcgtgtccgtatcggcggcg
atcggcggagatcgcgccttcggtgaactcggtccgatctcggtgaccgtcgacgctccg
gaccgcacgatcgcatcgttcgttctggacgccggcacgaccgaacggacgatgcatttc
gccgagatctaccgacgcgccgggcagtggcgtctccgcgcggtggggcaggggtacgaa
tacgatctcgccacgctcgccaccgagtacggggtgacggtcgacgattga

KEGG   Rhodococcus opacus PD630: Pd630_LPD11031
Entry
Pd630_LPD11031    CDS       T03071                                 

Definition
(GenBank) DNA polymerase III polC-type
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03430  Mismatch repair
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD11031
   03430 Mismatch repair
    Pd630_LPD11031
   03440 Homologous recombination
    Pd630_LPD11031
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD11031
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD11031
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD11031
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pd630_LPD11031
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     Pd630_LPD11031
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AHK35606
LinkDB
Position
p3:complement(22050..24188)
AA seq 712 aa
MECRRVVIAYASCAVGARASKGGTQPAGNYVLALTKHGHGNGYSAACIKEVGSPLQIYKG
YGAHITVDSARLVISKSNVVHMIGGPGAVLPLRAINGSNLKRASRFKNGHLQVLADGVLP
GKPSATEPYTVVFTHRQQATFLSVHEWLHAVTLANRQSSDTTTPIPAGMRGRGDADQSAS
TIPSGVQSPEMPSPTPARVSDLIGFRVPNEEPVEWMEQGRPGKVVRPSVRESPPTASDVL
PTGIDRLLLTRRVTGFAVSDQIFTAVDIETTGLDPASDGIVEIGAVKFTATGEVIDEFAT
LVNTPGSSESARAVHQIQDQDLDGAPDLAAVLPALLDFIRGTVLVAHNLDFEEPFLTAAF
QRHGPVLPAISAVCTLQTCRRQLEGRAFSLKAMFKTATGNWLENHHSALADARATAQILQ
WLVKTAPSMLYLSGPPAAEIRPRATHQCSTKPRPAPKGATLAAVVDSLPHSSTGLTGDPI
EFALYKEALSRHLEGGRLSVADVNTLAEHARRTRVTGNQLRELHRQRWEAAFPDEAHADW
SQLAQPRRCEMLAVAKALGVPDIFEPLQEVILAKTEPAPPPESRYLKGIRIGLSGESPEI
LALKEQAVGHGASVAVKITKTVVWLATTTPKSTDRTHNKARELNIPIIDAAEAKRRLDEA
LASAELDIFERRRQYQLFESERQREREEQDAYWRPTWRDIELTFDKPATGFE
NT seq 2139 nt   +upstreamnt  +downstreamnt
gtggagtgtcgcagggttgttatagcttatgcatcatgcgcggtgggcgcgcgagcttcc
aagggtgggactcagcccgctggcaactacgtcctcgctcttacgaagcatgggcatggg
aatggatattctgctgcatgcattaaggaggtcggtagcccgttgcagatttataagggg
tatggcgcccacataaccgttgacagtgctcgactcgtcatctcgaagtccaacgtagtg
cacatgatcggtgggccaggtgctgtcctcccattgcgcgccatcaatggatcgaatctg
aaacgggcaagcagattcaagaacggacacctccaagtacttgccgacggtgtgcttccc
gggaagccctcggctacagagccatacaccgtcgttttcactcaccgtcaacaggcaacc
ttcctgtcagtgcacgagtggctccacgccgtgacgcttgcgaatcggcaatcgtcagac
acaacgactccgattcccgcggggatgcgtgggcgcggcgatgccgaccagtcggcgtcg
acgatcccgtcgggtgtgcaatctcctgagatgccgtcaccgacaccagcgcgtgtcagc
gatctcatcggtttccgggtgcctaatgaggaaccagttgagtggatggagcagggcaga
ccggggaaggtggtccggccatcggtacgggagtcgccgccgactgcgtctgacgttctc
ccgaccgggatcgaccgattgttgttgacccggcgtgtcacaggatttgcagtgtccgat
cagatcttcacagcggtagatatcgagacaactgggctcgacccggcatcggatgggatt
gtcgagatcggcgcagtcaagttcacggcaactggtgaagtaatcgacgaattcgcgacc
ttggtgaatactccgggttcaagtgaaagcgcacgggctgtgcatcagatccaggatcag
gatctcgacggggccccagaccttgcagcggtgcttccggcactcctcgacttcatacgc
ggcaccgtgcttgtcgcccataacttggatttcgaagagcccttcctgacggctgcgttc
caacgacatgggccagtgcttcccgcaatatctgcggtctgcacattgcagacctgccga
cggcaactcgagggccgagcattcagcctcaaggccatgttcaaaaccgcgaccggtaac
tggctagaaaatcatcacagtgccctagcggatgcgcgagccaccgcgcaaatactgcag
tggctcgtcaagacagcaccctccatgttgtacctgtccggtccgcccgccgccgagatc
cgaccccgcgcaacacatcaatgctcgaccaagccgcggcctgccccgaagggtgcaacg
cttgctgcagttgtcgattctctcccgcacagctcgaccggtctcacgggcgaccccatc
gagtttgccctgtacaaggaggcgttgagcaggcacctggaaggcggtcgactgtccgtc
gccgatgtcaacaccctcgccgaacacgctcgacggacgcgagtgacagggaatcagctg
cgcgaactccatcgtcaacgatgggaggccgccttccccgacgaggcgcacgcagactgg
agtcagctcgcacagccccgaagatgcgaaatgctggccgtggccaaggcgctcggtgtc
cccgacatttttgaaccgctgcaagaggtcattcttgccaaaaccgaaccggcgcccccg
ccggaatctcgctacctgaaggggattcgaatcgggctttccggggagtcccctgagatc
ctggcgctgaaggaacaggccgtcggccacggcgcctctgtcgctgtaaaaatcaccaag
accgttgtctggctcgccacaaccaccccgaagtcgaccgatcggacacacaacaaggcg
cgtgagctcaacatcccaatcatcgatgccgccgaggcgaaacgacgcctcgacgaggcg
ctggcgagcgcggaactggacattttcgagcggcgccggcagtaccagctgttcgaatcc
gagcgccaacgtgaacgagaagagcaggatgcgtactggcgtccgacatggcgtgatatt
gaacttaccttcgacaaaccggcaacaggatttgaatag

DBGET integrated database retrieval system