KEGG   Rhodococcus opacus PD630: Pd630_LPD00004
Entry
Pd630_LPD00004    CDS       T03071                                 

Definition
(GenBank) DNA replication and repair protein recF
  KO
K03629  DNA replication and repair protein RecF
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD00004
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00004
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD00004
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 AAA_33 SbcCD_C ABC_ATPase ABC_tran
Other DBs
NCBI-ProteinID: AHK27255
UniProt: W8GTL7
LinkDB
Position
4851..6083
AA seq 410 aa
MFVRALSLRDFRSWDALGLTLRPGCTVFVGPNGHGKTNVLEALGYLSTLSSHRVSSDAPL
IRTGTGQAFAGATVVNAGRELTVDLELNEGKSNRARINQSPTRRPREILGILQTVLFAPE
DLSLVRGDPGDRRRYLDELLTSRLPRMAAVRADYDRVLRQRSALLKTAGGALRRVSRGGG
QPSEDGASALATLEVWDGHLAAHGAQLLAGRLHLVHDLAPHLAESYQSLAPESRPASIRY
RSSLGSSLPPEFTEPARVPDAGDIAFLEERFLQELSVMRSKEIERGVCLVGPHRDDLELQ
LGDTPAKGFASHGESWSFALSLRLAGFALLRSEGSDPVLMLDDVFAELDRRRRRALAKVA
LDAEQVLITAAVPEDVPEELDAVRFGVEARDTDRGRISHIVEETEDRRDG
NT seq 1233 nt   +upstreamnt  +downstreamnt
gtgttcgttcgcgcactctcgctcagagacttccgctcctgggacgccctcggtctcacc
ctgcgtccgggctgcaccgtcttcgtcggacccaacggtcacggcaagacgaacgtgctc
gaggcgctcggctacctgtcgaccctctcgtctcatcgggtcagctcggacgccccgctg
atcaggacggggaccggtcaggcattcgccggggccacggtcgtcaacgccggccgggaa
ctgaccgtcgatctcgagttgaacgagggcaagtccaaccgggcacggatcaaccagtcg
cccacccggcggccgcgggagattctcgggattctgcagacggtgctgttcgcgccggaa
gatctgtcgctggtccgcggcgatccgggtgatcggcggcgctacctcgacgagctcctc
acgtcccgactcccgcggatggcggcggtgcgcgccgattacgaccgggtgctgcggcag
cggtcggcgctgctcaagaccgcaggcggcgcgttgcgacgggtgtcgcgcggcggcggc
cagccgagcgaggacggcgcgagtgcccttgccacgctggaggtctgggacggacatctc
gccgcacacggcgcgcagctgctcgccggacggcttcacctcgtccacgatctcgctccg
catctggccgagtcgtaccaatcgctggcgccggagtcgaggcccgcgagcatccgctac
cgctcgagtctgggctcgtcgctgccgccggagttcaccgaaccggctcgagtgcccgat
gcgggcgatatcgcgtttctcgaggagcggttccttcaggagctgtccgtgatgcgctcc
aaggagatcgagcggggtgtgtgtctcgtcggcccgcatcgtgacgatctcgaactgcaa
ctcggcgacaccccggcgaagggattcgcgagtcacggtgagtcgtggtcgttcgcgctg
tcgttgcggctggcgggattcgccctgctgcgttcggagggcagcgatcccgtcctcatg
ctcgacgacgtgttcgcggagctcgatcgacgtcgacggcgcgcactcgccaaggtcgcg
ttggatgcggaacaggtgctcatcacggcggccgtgccggaagatgttccggaggagctc
gacgccgtccgattcggcgtggaggcccgcgacaccgatcgaggacgaatatcgcacatt
gtggaagagacggaggaccgccgtgacggatga

DBGET integrated database retrieval system