KEGG   Rhodococcus opacus PD630: Pd630_LPD00319Help
Entry
Pd630_LPD00319    CDS       T03071                                 

Definition
(GenBank) Uncharacterized protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
roa  Rhodococcus opacus PD630
Pathway
roa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:roa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pd630_LPD00319
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:roa02000]
    Pd630_LPD00319
Transporters [BR:roa02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    Pd630_LPD00319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_11 SBP_bac_6 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AHK27563
UniProt: W8H338
LinkDB All DBs
Position
318205..319386
Genome map
AA seq 393 aa AA seqDB search
MTHEQGDLRRSAPWTARGKVRRRLGALAATAVTAGALTACGVGQDFSDYPVALPDYYPSD
YASSVVEASKNEGGALTIYSSTDQQSWAPIFKAFQKKYPWVDGINATNLDSDEVFQRVLS
EQAIGQTSADVIVTGAADAWADFVERPGTVAPYQSPEKDHLPDFAEALPSVYSLSVDPIS
MIYNTALLNEQERPTGIADLAEKVTADPDRFDGAVTVRNPKGAFGFTVTRAFVENDPAAW
DALAQILPYSKNETSTGSQVEKVTAGEYSVGFFMGSPALTAEQRTGGLIKAVFPDDGTPL
LRRGMSMLQGAPHPATAKLFTDFVLSADGQAAVAEGGLTAYRDGVERADGGVPTYSDVIA
SVGEENTILIPYTKASDEEIQQFSDRWSSLQAG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacacacgagcagggtgacctgcggcgcagcgcaccgtggaccgcacggggaaaggtg
cgccgacgactcggcgcactcgccgccacggcggtgaccgcgggcgcgctcaccgcctgc
ggggtcggccaggacttcagcgattacccggtggcgctgccggactactacccgagcgac
tacgcctcgtccgtcgtcgaagcctccaagaacgaaggtggtgctctcaccatctattcg
agcaccgaccagcagagctgggccccgatcttcaaggcgttccagaagaagtacccgtgg
gtggacggcatcaacgccaccaacctcgacagcgacgaggtcttccagcgggtgctcagc
gagcaagcgatcggccagacgtcggcggatgtcatcgtcaccggagccgccgacgcctgg
gccgacttcgtcgaacgccccggaacggtggccccctaccagtccccggagaaggaccat
ctgcccgacttcgccgaggccctgccctcggtgtactcgctgtcggtggatccgatctcg
atgatctacaacaccgcacttctcaacgaacaggagcggccgaccggaatcgccgacctc
gccgagaaggtgacggcggatccggatcgattcgacggcgccgtgaccgtccgaaaccct
aagggcgcgttcgggttcaccgtgacccgtgcgtttgtcgagaacgatccggccgcctgg
gatgccctcgcgcagatcctgccctacagcaagaacgagacgtccaccggatcgcaggtg
gaaaaagtcacggccggtgagtattccgtcgggttcttcatgggctcaccggccctgacc
gccgagcagcgcaccggcggactgatcaaggcggtcttcccggacgatggcacgccgctg
ttgcgccgcggaatgtcgatgttgcagggcgccccgcacccggcgaccgcgaagctgttc
accgacttcgtgttgtccgcggacgggcaggccgctgtggccgagggcggactgaccgcc
taccgcgacggggtggagcgcgccgacggcggtgtgcccacctacagcgacgtcatcgcc
tcggtaggcgaagagaacacgatcctcatcccgtacaccaaagcatccgacgaggagatc
caacagttttcggaccgttggtcttcgttgcaagccggctga

DBGET integrated database retrieval system