KEGG   Rhodococcus opacus PD630: Pd630_LPD00548
Entry
Pd630_LPD00548    CDS       T03071                                 

Definition
(GenBank) NaeI very short patch repair endonuclease
  KO
K07458  DNA mismatch endonuclease, patch repair protein [EC:3.1.-.-]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00548
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Pd630_LPD00548
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     Pd630_LPD00548
SSDB
Motif
Pfam: Vsr MTES_1575 DUF559
Other DBs
NCBI-ProteinID: AHK27789
UniProt: W8GYN7
LinkDB
Position
complement(542635..543039)
AA seq 134 aa
MPATDPATSARMRSQRRRDTAPELALRRELHRRGVRYYVDRAPVKGVRRRADLVFPRRKV
AVYVDGCFWHSCPQHATFPKNNAQWWAEKLAGNVTRDRDTDARLTDAGWTVVRIWEHENP
VVAADRVQEALDDA
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcccgccaccgatcccgcaaccagcgcccggatgcggtcgcagcggcgtcgcgacacc
gcacccgaactcgcactgcgccgggaactgcaccggcgcggggtccggtactacgtggac
cgggcgccggtgaagggcgtccggcggcgcgccgacctggtgtttccgcgacggaaggtg
gccgtgtacgtggacgggtgcttctggcacagctgccctcagcacgccacgttcccgaag
aacaacgcgcaatggtgggccgagaaactcgccgggaacgtcacccgcgatcgtgacacc
gacgcgaggctgaccgacgccgggtggacggtggtgcggatctgggaacacgagaatccg
gtggtcgccgcggacagggtccaggaagctctggacgacgcgtga

DBGET integrated database retrieval system