KEGG   Rhodococcus opacus PD630: Pd630_LPD00612
Entry
Pd630_LPD00612    CDS       T03071                                 

Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD00612
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00612
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD00612
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pd630_LPD00612
SSDB
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 zinc_ribbon_2 DUF4187 IMS_HHH zn-ribbon_14
Other DBs
NCBI-ProteinID: AHK27851
UniProt: W8GR77
LinkDB
Position
606336..606944
AA seq 202 aa
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLSVEPPEIDRLKNALQRVRDGVQFCVVCG
TVSDKEHCRICADPRRDRTVICVVEEPKDVQAVERTREFKGRYHVLGGALDPLSGVGPDQ
LRIRELLARIGNQEDGVDVSEVIIATDPNTEGEATATYLVRMLRDFPGLTVSRLASGLPM
GGDLEFADELTLGRALSGRRTL
NT seq 609 nt   +upstreamnt  +downstreamnt
gtgtacgaaggtccggttcaggatctgatcgacgagctcggcaagctgcccggcgtcggg
ccgaagagcgcacagcgcatcgcgttccacctgctcagcgtcgagccgccggagatcgac
cggctcaagaatgcgctgcagcgggtgcgcgacggcgtccagttctgcgtggtgtgcggc
acggtctccgacaaggagcactgccgcatctgcgccgatccgcgccgtgaccgcacggtg
atctgtgtggtcgaggagccgaaggacgtccaggccgtcgagcgcacgcgcgagttcaag
ggccgctatcacgtcctgggcggcgcgctggatccgctgtccggggtgggccccgatcag
ctccgtatccgggagttgctcgcgcgcatcggcaatcaggaggacggcgtcgacgtctcc
gaggtgatcatcgcgaccgaccccaacaccgagggggaggccaccgcgacgtatctggtg
cggatgctgcgggacttccccgggctgacggtcagcaggctcgcgtcgggtctgccgatg
ggcggcgacctcgagttcgccgacgagctcacgctgggcagggcgttgtcggggagacgc
acgctgtga

DBGET integrated database retrieval system