KEGG   Rhodococcus opacus PD630: Pd630_LPD00681Help
Entry
Pd630_LPD00681    CDS       T03071                                 

Definition
(GenBank) Putative aldehyde dehydrogenase
Organism
roa  Rhodococcus opacus PD630
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHK27920
UniProt: W8GVE5
LinkDB All DBs
Position
690487..691965
Genome map
AA seq 492 aa AA seqDB search
MSAPKTAGIDCDFIEYKELFIGGRWVTPAGSDVIEVVNPHNGEPVGRVPHASRADVDAAV
AAARDAFDHGAWPRLPLEERLSVLMRLSEGLKARVPEMARLITRQNGSPIRWSLAAQAAA
PAAMYAVAAQIARSFPFEERRDGLKNPVLIRREPVGVVAAVVPWNVPEFVTSLKLGPALA
AGCAVVLKPSPETPLDANLLAEVAEEAGLPAGVLSVLPAGREVSEYLVSHPGVDKVSFTG
SVAAGKRVMEVAAGNLTRVTLELGGKSAALILPDADLDAAVAAITAASWTLNSGQACIAL
TRVLAPRTRYEEVAERLTAAVSALVVGDPLDPATQVGPMVTRRQQERNLDYLRIGLEEGA
TLLAGGGVPDGLDGGCYVRPTLFGDVDNSMRIEREEIFGPVVCLLPYETEDDAVRIANDS
DFGLSGAVFTADQDHGIDIARRIRTGTITVNGFATEPTAPFGGYKHSGIGREMGADGLAS
FLESKTIALPGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgccgaagaccgcgggaatcgactgcgactttatcgagtacaaggagctcttc
atcggagggcggtgggtgacaccggccgggtcggacgtcatcgaggtggtgaatccgcac
aacggtgaaccggtgggacgggttccgcatgcgagccgcgccgacgtcgacgctgcggtc
gcggctgcacgcgacgccttcgatcacggtgcgtggccgcgacttcccctcgaggaacgg
ctgtcggtcctgatgcgcctgagcgaaggactgaaagcgcgggtccccgaaatggcgcgc
ctgatcacccggcagaacggctcgccgatccgctggagcctggccgcgcaggcggcggca
ccggccgccatgtatgccgttgcggcgcagatcgcccgcagctttccgttcgaggaacgc
cgtgatggcttgaagaatccggtgctgatccgccgcgagcccgtgggtgtcgttgcggcc
gtggttccgtggaacgttcccgagttcgtcacttcgctgaagttgggaccggcgctggct
gcggggtgcgccgtggtgctcaagccgtcaccggagaccccgctcgacgccaatctgctg
gccgaggtcgcggaggaggcgggactgccggccggagtgctcagcgtgctgccggcgggt
cgcgaagtcagcgagtacctcgtgtcgcatcccggcgtcgacaaggtgtcgttcaccggc
tccgtggcagccggaaagcgcgtgatggaagtcgccgcaggcaatctcacgagggtgacc
ctcgaactcggtggaaagtctgcggcgctgattcttcccgatgccgatctggacgcagcg
gtcgccgcgatcaccgccgcctcctggactctcaacagtgggcaggcgtgtatcgcgctc
acccgggtcctggctcctcgcactcgctacgaggaagtggccgagcggctgacggccgcg
gtgtcggctctcgtggtcggtgatccgctggatccggccacccaggtggggccgatggtg
acgcgccggcagcaggagcgcaacctcgactacctccgcatcggactggaggagggcgcc
accctgctcgccgggggcggcgttcccgacggcctcgacggcggctgctacgtccggccc
accctgttcggcgacgtcgacaactccatgcgcatcgagcgtgaggaaatcttcgggccg
gtggtgtgcctgctcccttacgagacggaggacgacgcggtccggatcgccaacgactcc
gacttcggactctccggcgccgtgttcacggccgatcaggaccacggcatcgacatcgcg
cgacggatccgcaccggcacgatcaccgtcaacggtttcgccaccgaaccgacggctccg
ttcggcggatacaagcactccggcatcggccgggagatgggcgccgacggtctcgcgtcg
ttcctggagtccaagaccatcgccctgcccgggcggtag

DBGET integrated database retrieval system