KEGG   Rhodococcus opacus PD630: Pd630_LPD00769
Entry
Pd630_LPD00769    CDS       T03071                                 

Definition
(GenBank) Endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pd630_LPD00769
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00769
Enzymes [BR:roa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Pd630_LPD00769
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pd630_LPD00769
 Prokaryotic type
     Pd630_LPD00769
SSDB
Motif
Pfam: HhH-GPD HHH EndIII_4Fe-2S DUF3048 HHH_5
Other DBs
NCBI-ProteinID: AHK28006
LinkDB
Position
778638..779483
AA seq 281 aa
MSQKRHSGDSDRSGIRRVDPVHATPSDGSEVRGRTRSRAAKQDETRIGLVRRARRMNRRL
AEAFPHVYCELDFTTPLDLAVATILSAQCTDVRVNMVTPALFARYPDAKAYAEAERTELE
EYIRSTGFYRNKTNSLIGLGQALLERFDGEVPGNLKDLVTLPGIGRKTANVILGNAFDVP
GITVDTHFGRLVRRWKWTEEEDPVKVEHAIGALIERKEWTLLSHRVIFHGRRVCHARKPA
CGVCVLAKDCPSYGLGPIDPDVAAELVRGPETEHLLRLAGR
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctcagaagcgacacagcggcgattcggatcggtcgggtatccgtagagttgatccc
gtgcatgcgacccccagcgacggctccgaagtgcgtggacgcacccgttcgcgggccgcg
aaacaggacgaaacccggatcggactcgtccggcgcgcccggagaatgaaccggcggctc
gccgaggccttcccacacgtctactgcgagctcgacttcaccaccccactcgacctcgcc
gtcgcgaccatcctctccgcgcagtgcactgacgtgcgggtgaacatggtgacgccggcg
ctgttcgcccgctatcccgacgccaaggcgtacgcggaggccgaacgcaccgaactcgag
gagtacatccggtccacgggcttctaccgcaacaagacgaattctctgatcgggctgggg
caggctctgctcgaacgcttcgacggcgaggtccccggcaacctgaaggacctcgtgacg
ctgcccgggatcgggcggaagacggccaacgtgatcctcggcaacgcgttcgatgtgccg
ggaatcaccgtcgacacccacttcgggaggctcgtccgacgctggaagtggaccgaggag
gaagacccggtcaaggtcgagcacgcgatcggcgccctgatcgagcgcaaggagtggacg
ctgctctcgcaccgcgtgatcttccacggcaggcgcgtctgccacgcccgcaagcccgcc
tgcggggtgtgtgtgctcgccaaggactgtccgtcgtacgggctgggcccgatcgacccc
gacgtcgccgccgaactggttcgtggaccggagacggagcatctgctgcgtctggccggc
aggtga

DBGET integrated database retrieval system