KEGG   Rhodococcus opacus PD630: Pd630_LPD00800
Entry
Pd630_LPD00800    CDS       T03071                                 

Definition
(GenBank) DNA topoisomerase 1
  KO
K03168  DNA topoisomerase I [EC:5.6.2.1]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD00800
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00800
Enzymes [BR:roa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     Pd630_LPD00800
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Topoisomerases
   Pd630_LPD00800
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Pd630_LPD00800
SSDB
Motif
Pfam: Topoisom_bac Toprim_C_rpt Toprim Toprim_4 HC2 SPESP1
Other DBs
NCBI-ProteinID: AHK28038
UniProt: W8H4I0
LinkDB
Position
811244..814162
AA seq 972 aa
MAKGDNGSAQGAAGASGQPRRLVIVESPTKARKIAPYLGKNYVVEASVGHIRDLPRGAAD
VPAKYKGESWARLGVNVDHDFEPLYVVSPEKKSKVTELKSLLKDADELFLATDPDREGEA
IAWHLLETLKPKIPVRRMVFHEITEPAIRAAAEDTRELDNDLVDAQETRRILDRLYGYEV
SPVLWKKVMPRLSAGRVQSVATRVIVQRERERMAFRSASYWDISATLDAGAEASPRSFGA
RLVSVDGSRVATGRDFGADGRLKTSTVTVLDEARAQRLAESLAGVDLTVSSAESKPYTRK
PYAPFMTSTLQQEAGRKLRFTSERTMRIAQRLYENGYITYMRTDSTTLSSSAIAAARAQA
TELYGAEYVHDTPRQYTRKVKNAQEAHEAIRPAGDVFQTPGQLHSRLDTDEFRLYELIWQ
RTVASQMADARGTTLTLRITGTAGTGEECTFSASGRTITFAGFLKAYVESVDEEAGGQSD
DAESRLPVLVEGQAVTATKLDPDGHTTNPPARYTEASLIKTLEELGIGRPSTYSSIIKTI
LDRGYVYKRGSALVPSWVAFAVIGLLEMHFGRLVDFDFTAGMEDDLDAIAGGREQRGNWL
SSFYFGGDHGAEGSVAREGGLKKMVGVNLEEIDAREVNSIRLFDDAEGREVHVRVGRFGP
YLERMVQNPDDPDGDLISQRANLPDDLPPDELTPEYAEKLFSTPQEGRKLGVDPLTGHEI
VAKEGRFGPYVTEILPEPEPEPEPAVVPVTDESGDGTTKTKTAAKKAPAKKAAKKATGPK
PRTGSLLKSMDLATVTLDDALKLLSLPRVVGVDPESKEEITAQNGRYGPYLKKGTDSRSL
ATEDQMFTVTLDEALKIYAEPKRRGRQAAATPPLRELGVDSVSEKPMVIKDGRFGPYVTD
GETNASLRKGDEVESITDARASELLADRRARGPVKKKAAAKKAPAKKAAKKTAAKKAPAK
KAASKKAADKKA
NT seq 2919 nt   +upstreamnt  +downstreamnt
gtggctaaaggggacaacggcagtgcacagggtgcggcgggagcgtccggccagcctcgc
cgcctcgtgatcgtcgagtcgccgaccaaggcccgcaagatcgccccgtacctcggaaag
aactatgtcgtcgaggcgtcggtcggccacattcgcgaccttccgcgcggagccgcagac
gtcccggccaagtacaagggtgagtcgtgggcgcggctcggcgtcaacgtcgaccatgat
ttcgaaccgctctacgtggtcagtccggagaagaagtccaaggtcacggagctgaaaagc
ctgctcaaggacgccgacgaactcttcctcgccaccgaccccgaccgcgagggcgaagcg
atcgcctggcacctcctcgagacgctcaagccgaagatcccggttcgccggatggtcttc
cacgagatcaccgagccggccatccgagccgcggccgaggacacccgcgaactcgacaac
gacctggtcgacgcgcaggagacccgccgcatcctcgaccgtctgtacggctacgaggtc
agccccgtgctgtggaagaaggtcatgccgaggctgtcggcgggccgcgtgcagtccgtc
gccacccgcgtcatcgtgcagcgcgaacgcgagcggatggccttccgctcggcgtcctac
tgggacatctccgccaccctcgatgccggcgccgaggccagcccccgcagtttcggggcg
cgtctggtgagcgtcgacggctcccgggtggccaccggccgcgacttcggcgcggacggc
cggctgaagacgagcaccgtcacggttctggacgaggcgcgggcgcagcgtctggccgag
tccctcgccggtgtcgatctgaccgtctcctccgcggagagcaagccgtacacccgcaag
ccgtacgcgccgttcatgacgtcgacgctgcagcaggaggcgggccgcaagctccggttc
acgtccgagcggacaatgcgcatcgcgcagcggctgtacgagaacggctacatcacctac
atgcgtaccgactcgacgacgctgtcgtcgtcggcgatcgctgccgcccgcgcgcaggcc
accgagttgtacggcgccgagtacgtgcacgacacaccgcgccagtacacgcgcaaggtc
aagaacgcgcaggaggcgcacgaggccatccgcccggccggcgacgtgttccagacccct
ggtcagctgcactcccgcctcgacacagacgagttccgtctgtacgagctgatctggcag
cggaccgtggcgtcgcagatggccgacgcgcggggcacgacgctgaccctgcggatcacg
ggaaccgcgggcaccggcgaggagtgcaccttctccgcgtcgggccgcaccatcacgttc
gccggattcctgaaggcctacgtggagagtgtcgacgaggaggccggcggccagtccgac
gacgccgagtcgcgcctgccggtgctcgtcgagggccaggcggtcaccgccaccaagctc
gatcccgacggccacaccaccaacccgcccgcccgttacaccgaggcgagcctgatcaag
accctcgaagagctgggcatcggccgcccgtccacctattcgtcgatcatcaagaccatt
ctcgatcgcggatacgtctacaagcgcggcagcgcgctggtcccgtcctgggtggcgttc
gcggtcatcggcctcctcgagatgcacttcgggcggttggtcgacttcgacttcaccgcc
gggatggaggacgacctcgacgcgatcgccggtggccgggaacagcgcggcaactggctg
agcagtttctacttcggcggcgatcacggcgccgaggggtcggttgcccgtgagggcggc
ctgaagaagatggtcggcgtcaacctcgaggagatcgacgctcgcgaggtcaactcgatc
aggctcttcgacgacgccgagggccgggaagtgcacgtccgcgtcggacggttcggtccg
tacctcgagcgtatggtccagaacccggacgaccccgacggcgacctcatctcccagcgg
gccaacctgcccgacgaccttcccccggacgagctgactccggagtacgcggagaagctg
ttctcgaccccgcaggagggtcgcaagctgggcgtcgacccgctgaccgggcacgagatc
gtcgcgaaggagggccgcttcggcccttacgtcaccgagatccttcccgagccggaaccg
gagcccgaaccggcagtggtgccggtgaccgacgaatcgggcgacgggacgaccaagacg
aagacggctgccaagaaggcgccggcgaagaaggcggcgaagaaggccaccggtccgaag
ccgcggacgggttcgctgctcaagtcgatggacctggcgacggtgactctcgacgacgcc
ctcaagctgctgtcgctgccgcgcgtggtgggtgtcgatccggagtccaaggaagaaatc
accgcgcagaacggtcgctacggcccgtatctgaagaaggggacggattcgcggtccctc
gccaccgaggaccagatgttcacggtgaccctcgacgaggctctgaagatctacgcggag
cccaagcgtcgcggacgtcaggccgccgccaccccgccgctgcgtgagctgggtgtcgac
tcggtcagcgagaagccgatggtgatcaaggacggccggttcgggccgtacgtgaccgac
ggtgaaaccaacgccagcctccgcaagggcgacgaggtggagtccatcaccgacgctcgc
gcttcggaactgctggcggatcggcgtgcccgcggtcccgtcaagaagaaggccgccgcg
aagaaggcgcccgccaagaaggctgcaaagaagaccgccgccaagaaggcgccggccaag
aaagcggcctcgaagaaggcagcggacaagaaggcgtga

DBGET integrated database retrieval system