KEGG   Rhodococcus opacus PD630: Pd630_LPD00902
Entry
Pd630_LPD00902    CDS       T03071                                 

Definition
(GenBank) DNA repair protein RadA
  KO
K04485  DNA repair protein RadA/Sms
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD00902
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD00902
SSDB
Motif
Pfam: AAA_25 ATPase ChlI DnaB_C AAA_22 Lon_C Rad51 NACHT AAA_16 AAA_30 AAA AAA_19 NTPase_1 Peripla_BP_4 RsgA_GTPase ABC_tran AAA_24 AAA_5 Hpr_kinase_C MMR_HSR1 AAA_29 AAA_14 MCM DUF2075 DAP3 NB-ARC PAXNEB AAA_11
Other DBs
NCBI-ProteinID: AHK28136
LinkDB
Position
complement(909059..910345)
AA seq 428 aa
MDEAPIVASVASRPGASLAKAGAGAVLPSTPATPITRIDSTSTRAKPTGIDELDRVLGGG
VVPGSVVLLAGEPGVGKSTLLLEVVHQWARRGPDDRSLYVTGEESAGQVRLRADRTGAVH
ERVYLAAESDLATILGHVEQVRPTLLIVDSVQTMLAADVDGVVGGVTQVKAVTSALTSLA
KASGVPVLLIGHVTKDGAVAGPRSLEHLVDVVLHFEGDKHSTLRMVRGVKNRFGAADEVG
CFELREDGIAGISDPSGLFLHHRAEAVPGTAVTVMMDGKRPLLGEVQALVAATSMPAPRR
AVSGLDSARVAMVLAVLDRRCGVPIAKNDVYAATVGGMRMTEPSADLALALAVASAVRDK
PVPDGLVILGEVGLAGEVRRVPGVGRRLAEAYRLGFTRAIVPLDSGAAPKGMKVTEVGNL
GAAIASLR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggacgaggccccgatcgtcgcgtccgtcgccagccgccccggtgcctcgctcgcgaaa
gccggggccggagcggtacttccgtccaccccggccactccgatcacgcgaatcgacagc
acgtccacccgcgccaagcccacgggcatcgacgaactcgaccgtgtgctcggcggcggc
gtggtacccggttccgtcgttctcctcgccggcgaacccggcgtcggcaagtcgaccctg
ctcctcgaggtggtccaccagtgggcccgccgcggcccggacgaccgctccctctacgtc
accggtgaggaatccgccggacaggtgcggctgcgtgccgaccgcacgggtgccgtccac
gagcgggtctatctcgccgccgaatccgacctcgcgaccatcctcggtcacgtggagcag
gtgcgccccaccctgctgatcgtcgactccgtgcagaccatgctggccgcggacgtcgac
ggcgtggtcggcggagtcacccaggtgaaggccgtcaccagcgccctcacctccctcgcg
aaggccagcggcgtgccggtgctcctcatcggccacgtcaccaaggacggtgcggtcgcc
ggaccgcggtcgctcgagcatctcgtcgacgtggtgctgcacttcgagggcgacaaacac
tccacgctgcggatggtgcgcggcgtcaagaaccgtttcggcgccgccgacgaggtcggt
tgcttcgaactgcgggaagacggcatcgccggcatcagcgacccgtccggactgttcctt
catcaccgtgccgaggccgttcccggaaccgcagtcaccgtcatgatggacggcaagcgg
cccctcctcggtgaggtgcaggctctcgtggccgccacatccatgccggcaccccggcgt
gccgtgagcgggctcgacagcgcccgcgtggccatggtgctggccgtgctcgaccgccgg
tgcggggtgccgatcgcgaagaacgacgtctacgcggccaccgtcggcggaatgcggatg
accgagccctccgccgatctcgcgttggccctcgccgtcgcgtccgcggtcagggacaag
cccgttccggacggactggtgatcctcggcgaagtgggactggccggtgaggttcgccgg
gtacccggcgtcgggcgcaggctcgccgaggcctaccgcctcggattcacccgcgcgatc
gttcccctcgactccggggcggctccgaagggcatgaaggtcaccgaggtcgggaacctg
ggggcagccatcgcgtcactgcggtga

DBGET integrated database retrieval system