KEGG   Rhodococcus opacus PD630: Pd630_LPD01361Help
Entry
Pd630_LPD01361    CDS       T03071                                 

Definition
(GenBank) ATP-binding/permease protein CydC
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
roa  Rhodococcus opacus PD630
Pathway
roa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:roa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Pd630_LPD01361
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:roa02000]
    Pd630_LPD01361
Transporters [BR:roa02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    Pd630_LPD01361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_membrane Pox_A32 FtsK_SpoIIIE AAA_28 Mg_chelatase AAA_24 AAA_29 AAA_16 CbiA OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AHK28594
UniProt: W8H0T3
LinkDB All DBs
Position
1386629..1388362
Genome map
AA seq 577 aa AA seqDB search
MSRDPLIRALPLLDLQPGRVVRAVTAGVATLGSALALAALSAWLITRAWQMPPVLDLSVA
VVAVRALGISRGVFRYLERLATHDTALRGTTSARTQLYQRLADGDPAAAAGLRRGELLAR
TGADVDTLGDVVVRALVPIAVSVVLAVAAVGILAVISPASAVVLAVALAVSGVAAPWLSA
RAARLAETSGADARARFSEDAVTALDHAAELRVAGRLDRTVSRAVRSERAAVAATDRAAA
PSAFAEAATPLAVGVSVIASLLIGMDLYSSGTMSPMALGILVLLPLSAFEATVALPAAAV
ALTRARIASRRILVVLDAAVADPHPGDRELDGPAEVVAKDLRCGWPGGQATAPLDLDLRP
GFRVAIVGGSGSGKTTTLMTLAGLLPPVTGTVRVDGLDLHSVRSEALRRNVGFFAEDAHL
FDTSVLENLRVARGDIQDAEALTVLESVGLGGWVSALPEGVHTTLAGGARAVSGGQRRRL
LLARALLSPARVLLLDEPTEHLDADAGADLLRRLLARDGGLVSAQRTVVVVTHQLPEDTS
ADLVIRVEKAESENALPTPCVRRTFFSTRGRRWSEIE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtgacccgctgatccgggcattgccgctcctcgacctgcaaccgggacgggta
gtgcgggccgtcaccgccggcgtcgccacgctgggcagtgcgctcgcgctcgcggcgctg
tcggcgtggttgatcacgagggcgtggcagatgccgcccgtcctggacctcagcgtcgcc
gtcgtggcggtgcgggcgctgggcatctcccgcggcgtcttccggtacctcgagcggctg
gccacccacgacaccgcgctgcgcgggaccacgtccgcccgcacccagctgtaccagcgg
ctggccgacggtgaccccgcggccgctgccggcctgcgccgcggcgaactgctcgcccgc
accggggccgacgtcgacaccctcggtgacgtcgtcgtccgcgcgctcgtccccatcgcc
gtgtccgtcgtcctggccgtggccgccgtcggcatccttgcggtgatctcgcccgcctcg
gcggtcgtgctcgcggtggcgctcgcggtgtcgggggtcgcggcgccctggttgtccgcg
cgggccgcccgcctggcggagacgtccggcgccgacgcgcgtgcccggttcagtgaggac
gccgtcacggcgctcgatcacgccgcggaactccgcgtcgcgggtcgcctcgaccggacc
gtgtcgcgggcggtccgctccgaacgcgccgcggtcgcggccaccgaccgcgccgccgca
cccagcgcgttcgcggaggccgccacaccactcgcggtgggcgtgagtgtgatcgcgtcg
ctgctcatcgggatggacctgtactcgtcggggaccatgagcccgatggcgctgggcatc
ctcgtgctcctgccgctgtccgcgttcgaggccacggtcgcgctgcccgccgcggcggtc
gcgctgacccgggcccggatcgcgtcgcgccgaatactcgtcgtgctcgacgccgccgtc
gcggatccgcaccccggcgaccgggaactggacgggcccgcggaggtcgtcgcgaaggac
ctgcggtgcggctggcccggagggcaggccaccgccccgctcgacctcgacctgcggccc
ggcttccgagtcgcgatcgtcggcggcagcgggtccgggaagacgaccacgctgatgacc
ctggccgggttgctcccgccggtgacggggacggtgcgggtcgacggactcgacctgcac
agcgtcaggtccgaggctctccgccggaacgtcggattcttcgcggaggacgcacacctc
ttcgacacgtccgtcctcgagaatctgcgggtggcgcgcggcgacatccaggacgcggag
gcgctgaccgtcctggagtccgtcgggctcgggggatgggtgtcggcgctgccggagggc
gtgcacacgaccctcgccggcggtgccagggcggtgtccggtgggcagcgtcgccgcctg
ctcctcgcccgggcgctgctgtcgcccgcccgagtgctgttgctggacgaaccgaccgaa
cacctcgacgccgacgcgggcgccgacctgctccggcgactgctcgcgcgcgacggcgga
ctggtgtctgcgcagcggaccgtcgtggtggtcactcaccagcttccggaggataccagc
gctgacctggtgatacgggtggagaaagctgagagcgaaaatgcgttgccgactccgtgc
gtgcggcgtactttcttcagtacacgaggaaggaggtggtctgaaattgaatga

DBGET integrated database retrieval system