KEGG   Rhodococcus opacus PD630: Pd630_LPD01519
Entry
Pd630_LPD01519    CDS       T03071                                 

Definition
(GenBank) Deoxyribodipyrimidine photo-lyase
  KO
K01669  deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD01519
Enzymes [BR:roa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.3  deoxyribodipyrimidine photo-lyase
     Pd630_LPD01519
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    Pd630_LPD01519
 Prokaryotic type
    Pd630_LPD01519
SSDB
Motif
Pfam: FAD_binding_7 DNA_photolyase
Other DBs
NCBI-ProteinID: AHK28748
LinkDB
Position
1548162..1549502
AA seq 446 aa
MDTALVWFRRDLRLGDLPTLHTVAESGARALGLFVLDDRLLTTSGGARRDFLFRSLAALD
DRLDGRLLVVKGDPVDVVPRVAEKVSAEEVHVSADYGPYGRERDAAVAEHVELVATGSPY
AVAPGRVTKTDGEPYRVFTPYFRQWLEHGWRAPIDTGPATVEWVDPDDVKARRVQIPEPE
SDGYAAGEAAALQRWAEFCEDDLAGYEDARDRPGLDATSRMSVYLKYGNIHPRTMLRDLA
RRRSKSAEQYRRQLAWRDFYADILFQRPDSARGNYDRRFDHIRYDSGPDAEEAFTAWCEG
RTGFPIVDAGMRQLKAEAWMHNRVRMIVASFFVKDLHLPWWRGARYFMNQLVDGDLANNQ
HGWQWTAGSGTDASPYFRVFNPTTQGEKFDPDGEYVRRWVPELRGISGKAVHALKDGRPE
DYPPPIVDHAHERQEALARYGEIKAP
NT seq 1341 nt   +upstreamnt  +downstreamnt
atggacaccgcactcgtctggttccggcgcgacctccggctcggtgatctgccgacgctc
cacacggtggccgagtcgggggcgcgtgcgctcgggttgttcgtcctcgacgatcggctg
ctgacaacatcgggcggtgcgcgccgggacttcctgttccgcagtctcgccgcgttggac
gaccgactcgacggccggttgctggtggtgaagggcgatcccgtcgacgtggtcccgagg
gtggcggagaaggtgtcggccgaagaggtgcatgtcagcgccgactacgggccgtacggt
cgcgagcgtgacgccgcggtcgccgagcacgtcgaactcgtggccaccgggtcgccctac
gcggtggcaccgggccgggtgaccaagacggacggggagccgtaccgcgtgttcaccccg
tacttccggcagtggctcgaacacgggtggcgcgccccgatcgacaccggtccggcgacg
gtggagtgggtggacccggacgacgtgaaggcgcggcgggtgcagatccccgaacccgaa
tccgacgggtacgccgcgggtgaggcggcggcgctgcagcggtgggcggagttctgcgag
gacgacctcgccgggtacgaggacgcgcgcgatcgtcccggtctcgacgcgaccagccgg
atgtcggtgtacctgaagtacggcaacattcatccgcgcacgatgctccgcgatctcgcg
cgccgccgcagcaagagcgccgaacagtaccggcggcagctcgcgtggcgggacttctac
gccgacatactcttccagcgccccgacagcgcccgcggaaactacgaccgtcgcttcgac
cacatccgctacgacagtgggcccgacgccgaggaggcgttcacggcgtggtgcgagggc
cggaccgggttcccgatcgtcgacgccgggatgcgtcagctgaaagccgaagcctggatg
cacaatcgggtgcggatgatcgtcgcgtcgttcttcgtcaaggatctgcacctgccgtgg
tggcggggtgcccgctacttcatgaaccagctcgtcgacggcgatctggcgaacaatcag
cacggctggcagtggaccgcgggatcggggacggacgcgtcgccgtacttccgggtgttc
aacccgacgacgcagggggagaagttcgaccccgacggcgagtacgtgcggcggtgggtg
cccgaactgcgtggcatctccgggaaggccgttcacgccctgaaagacggtcgccccgag
gactatccgccgccgatcgtcgaccacgcccacgaacggcaggaggcgctcgcccgctac
ggcgagatcaaggccccgtga

DBGET integrated database retrieval system