KEGG   Rhodococcus opacus PD630: Pd630_LPD01627Help
Entry
Pd630_LPD01627    CDS       T03071                                 

Definition
(GenBank) putative DNA ligase
Organism
roa  Rhodococcus opacus PD630
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AHK28856
UniProt: W8GTU8
LinkDB All DBs
Position
1713209..1714252
Genome map
AA seq 347 aa AA seqDB search
MDLPVMPPLQPMLAKAASSVPAQPESGLAWSYEPKWDGFRTLVFRDGDEVVLGSRGGKDL
ARYFPELIRAVKDELPQRCVVDGELVVPRSIDGRTRLDWESLSERIHPAESRVTMLSEKT
PAQFVAFDLLALGDRDLSREDFSVRRAQLVDTIGGGPSCHVTAATESSATAIEWFEAFEG
AGLDGVVAKKLVGPYLPNKREMVKVKHARTADCVVIGYRPHKSQPGIGSVLLGLYDGDQM
AMVGGASAFTAARRIELLAELDELRVGDDVVADGAPTRWQSGNDRTWVPLRPERVVEVAY
DQMEGARFRHAARFLRWRPDRTPDECTFQQLEVPVRYDLADVLAGGS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtggatctccccgtgatgcctccgttacagccgatgctcgcgaaggctgcgtcgtccgtt
ccggcgcaaccggagtccgggctcgcctggtcctacgaaccgaaatgggacggtttccgc
accctcgtcttccgcgacggcgacgaggtggtgctcgggtcccgcggcggaaaggatctg
gccaggtactttcccgaactcatccgggcggtgaaggacgaactgccgcagcggtgcgtg
gtggacggcgaactcgtcgtcccgcgcagcatcgacggccgcacccggctcgactgggag
tcgttgtcggagcgcattcatccggccgagagccgggtgacgatgctgtcggagaagact
ccggcccagttcgtcgcgttcgatctgctcgccctgggcgaccgcgacctcagccgggag
gacttctccgtccgtcgcgcgcagctcgtcgacaccatcggcggtggacccagctgccac
gtcaccgccgccaccgaatccagtgcgacggccatcgagtggttcgaggcgttcgagggg
gccggcctcgacggggtggtggcgaagaagctggtgggcccgtacctgccgaacaagcgg
gaaatggtgaaggtgaagcacgcccgcaccgcggactgcgtcgtcatcggctaccggccg
cacaagagtcagccggggatcgggtcggtgctgctcggactgtacgacggcgaccagatg
gcgatggtcggcggtgcgtcggcgttcacggcggcgcggcggatcgaactgctcgccgaa
ctcgacgagctgcgcgtcggcgacgacgtcgtcgcggacggggcgccgacgcggtggcag
tcgggcaacgaccgaacctgggtgccgctgcgccccgaacgcgtcgtcgaggtggcgtac
gaccagatggagggtgcccggttccggcacgccgcgcggttcctgcgctggcgtccggac
cggacgcccgacgagtgcacgttccaacaattggaggtcccggtgcgatacgaccttgcc
gacgtcctggccggaggttcctag

DBGET integrated database retrieval system