KEGG   Rhodococcus opacus PD630: Pd630_LPD02037Help
Entry
Pd630_LPD02037    CDS       T03071                                 

Definition
(GenBank) putative aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00220  Arginine biosynthesis
roa00250  Alanine, aspartate and glutamate metabolism
roa00290  Valine, leucine and isoleucine biosynthesis
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
roa01130  Biosynthesis of antibiotics
roa01210  2-Oxocarboxylic acid metabolism
roa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pd630_LPD02037
   00290 Valine, leucine and isoleucine biosynthesis
    Pd630_LPD02037
   00220 Arginine biosynthesis
    Pd630_LPD02037
Enzymes [BR:roa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Pd630_LPD02037
    2.6.1.66  valine---pyruvate transaminase
     Pd630_LPD02037
Amino acid related enzymes [BR:roa01007]
 Aminotransferase (transaminase)
  Class I
   Pd630_LPD02037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Alliinase_C Aminotran_MocR Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AHK29263
UniProt: W8H8C7
LinkDB All DBs
Position
complement(2147560..2148822)
Genome map
AA seq 420 aa AA seqDB search
MTLVSNPDHGHHRMPHRKLEQSTKLQNVLYEIRGPVHAHAARLEAEGHRILKLNIGNPAP
FGFDAPDVIMRDMIAALPYAQGYSESKGILSARRAIVTRYELVAGFPELDVDDIYLGNGV
SELITMTMQALLDNGDEVLIPAPDYPLWTAMTSLAGGTPVHYLCDEGNDWNPDIADIESK
ITDKTKALLVINPNNPTGAVYSMEVLQQLVDLARKHQLLLLADEIYDKILYDDAKHISLA
TLAPDLLCLTFNGLSKAYRVAGYRSGWVAITGPKEHAAGFLEGLDLLASTRLCPNVPGQH
AIQVALGGHQSIEDLILPGGRLLEQRDVAWERLNMIPGVSCVKPKGALYAFPRLDPNVYE
IYDDEKLVQDLLLQEKILMVQGTGFNWPDHDHLRIVTLPWARDLAVAIERFGNFLTSYKQ
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtgagcaacccagaccacggccatcaccgcatgccgcaccgcaagctggag
cagtccaccaagcttcagaacgtgctctacgagattcgtggaccggtacatgcccacgcc
gcccggctggaggcggaaggccaccggatcctcaagctcaacatcggcaaccccgcaccg
ttcggtttcgacgcgccggacgtgatcatgcgcgacatgatcgccgcgctcccgtacgcg
cagggttactccgagtccaagggcatcctgtcggcgcggcgcgcgatcgtcacccgctac
gagctggtcgccgggttccccgaactcgacgtcgacgacatctatctgggcaacggtgtg
tccgagctcatcacgatgacgatgcaggcgctcctcgacaacggcgacgaggtgctgatc
ccggcaccggactacccgctgtggacggcgatgacgagcctcgccggcggaaccccggtg
cactacctgtgcgacgagggcaacgactggaaccccgacatcgcggacatcgagtcgaag
atcaccgacaagaccaaggcgctgctggtcatcaacccgaacaatccgacgggtgccgtg
tactcgatggaggtgctgcagcagctcgtcgacctggcgcgcaagcatcagctgctgctt
ctcgcggacgagatctacgacaagatcctctacgacgacgccaagcacatctcactggcg
acgctggccccggacctgctgtgcctgacgttcaacggcctgtcgaaggcgtaccgcgtc
gccggctaccggtccggctgggtcgccatcacgggaccgaaggaacacgccgcgggtttc
ctcgagggactcgacctgctggcgtcgacgcgtctgtgcccgaacgtgcccggtcagcac
gccatccaggtggcgctcggtgggcaccagagcatcgaagacctgatcctgccgggtggt
cgactgctcgagcagcgtgatgtggcctgggaacgcctcaacatgattcccggtgtctcc
tgcgtgaagccgaagggcgcgttgtacgcattcccccgcctcgacccgaacgtgtacgag
atctacgacgacgagaagctggtccaggaccttctgctgcaggagaagatcctgatggtg
cagggcaccgggttcaactggccggaccacgaccacctccgcatcgtgacgttgccgtgg
gcgcgtgatctcgctgtcgccatcgagcggttcggaaatttcctcaccagctacaagcag
tag

DBGET integrated database retrieval system