KEGG   Rhodococcus opacus PD630: Pd630_LPD02150
Entry
Pd630_LPD02150    CDS       T03071                                 

Definition
(GenBank) Methylated-DNA--protein-cysteine methyltransferase
  KO
K00567  methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02150
Enzymes [BR:roa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.63  methylated-DNA---[protein]-cysteine S-methyltransferase
     Pd630_LPD02150
DNA repair and recombination proteins [BR:roa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   Direct repair
    Pd630_LPD02150
 Prokaryotic type
    Pd630_LPD02150
SSDB
Motif
Pfam: DNA_binding_1
Other DBs
NCBI-ProteinID: AHK29376
LinkDB
Position
complement(2285728..2286264)
AA seq 178 aa
MTTGIALFDTALGTCAIAWRAAGIVGVQLPEGSPESTRQRLEHCFPDAVEHQPPAPVQRA
VDGIREHLGGALDDLRWIDLDFEGVPEFDCNVYDITRAIDPGTTLTYGDIAAELGKPGAA
QAVGQALGRNPLPIVIPCHRVLAAGGQVGGFSAGGGTLTKRELLALEHTPGFDDPVLF
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgaccacaggaatcgccctgttcgacacggccctcggcacctgcgccattgcgtggcgg
gccgcggggatcgtgggcgtgcaattgcccgaaggttcacccgaatccacccggcagcgt
ctcgaacactgcttcccggatgcggtggagcaccagccgccggcgccggtccagcgggcc
gtcgacggaatacgcgaacatctgggcggcgcactcgacgatctgcggtggatcgacctc
gacttcgagggagtccccgaattcgactgcaacgtatacgacatcacccgcgcaatcgac
ccgggcaccacgctcacctacggcgacatcgcggcggaactcggcaagccgggtgccgcg
caggccgtcggtcaggccctcggccgcaacccgctgccgatcgtgatcccgtgccatcgc
gtcctcgccgcaggcgggcaggtgggtggcttctccgccggcggcggcaccctcaccaag
cgcgaactgctggccctcgaacacactccgggtttcgacgacccggtgctgttctga

DBGET integrated database retrieval system