KEGG   Rhodococcus opacus PD630: Pd630_LPD02304Help
Entry
Pd630_LPD02304    CDS       T03071                                 

Definition
(GenBank) Uncharacterized protein y4nG
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00053  Ascorbate and aldarate metabolism
roa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Pd630_LPD02304
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Pd630_LPD02304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 Polysacc_synt_2 RmlD_sub_bind NAD_binding_4 NmrA
Motif
Other DBs
NCBI-ProteinID: AHK29529
LinkDB All DBs
Position
complement(2439547..2440371)
Genome map
AA seq 274 aa AA seqDB search
MTDTASRLLITGAAGNMGKMLRPLLRKPGRTLRLFDIADITDIDPEHEEFVQGSVTDRAA
VAAAVDGVDAVLHLGGLSTEDSWENILSVNVDGTQAVFEAAVAHGVTRVIAASSNHAVGF
WTHAEAGSNPLPGDVPPRPDGFYGWSKAAVEALGRLYHDRFGIDVVNLRIGSSFDRPPNY
RGLASWMSPADTARLIEAALSDSAKGFHTVWGISRNTRSWWSGAEGAAIGYEPQDDAEVF
ADEFLADHEWTFDDPILQRVGGAFCDHPLGQRMR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaccgcctcgcgtctgctgatcaccggcgccgcaggaaacatgggcaagatg
ctgcgccccctgctccgcaaacccggccgcaccctgcgcctgttcgacatcgccgacatc
accgacatcgaccccgaacacgaggagttcgtccagggttcggtcaccgaccgcgccgcc
gtagctgctgcggtcgacggcgtcgacgccgtacttcacctgggcggactcagcaccgag
gactcgtgggagaacattctgtccgtcaacgtcgacggcacccaggcggtgttcgaggcc
gccgtcgcacacggagtgacgcgcgtgatcgcagcgtcgagcaaccacgccgtcggtttc
tggacacacgcggaagccggctcgaacccgctgcccggcgacgtcccgccccgtccggac
gggttctacggctggagcaaggcagcggtcgaggcgctcggccggctgtaccacgatcgc
ttcggcatcgacgtcgtcaacctgcggatcggctcgagcttcgaccggccgcccaactac
cgcggcctcgcgtcctggatgtcaccggccgacaccgctcgcctgatcgaggctgcactg
tccgactccgccaagggatttcacaccgtgtggggtatctcgcggaacacccgcagctgg
tggtcgggagcagagggtgcagccatcgggtacgaacctcaggacgacgcagaggtgttc
gccgacgagttcctggccgatcacgaatggacgttcgacgatccgatcctccagcgtgtc
ggcggcgcgttctgcgaccacccgctcggacaacggatgcgctga

DBGET integrated database retrieval system