KEGG   Rhodococcus opacus PD630: Pd630_LPD02376
Entry
Pd630_LPD02376    CDS       T03071                                 

Definition
(GenBank) Transcription-repair-coupling factor
  KO
K03723  transcription-repair coupling factor (superfamily II helicase) [EC:3.6.4.-]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD02376
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02376
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Pd630_LPD02376
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     TRCF (transcription-repair coupling factor)
      Pd630_LPD02376
SSDB
Motif
Pfam: CarD_CdnL_TRCF UvrB_inter Helicase_C DEAD ResIII UB2H DUF3638
Other DBs
NCBI-ProteinID: AHK29600
LinkDB
Position
2519116..2522838
AA seq 1240 aa
MSSPLIAAEPSSDTPLAGLAKIALGDAVIAQVTEALGRHHLDIVAPAPARPFVAAALAER
THLLLVTATGREADDLTAELQEMIGDAVAQFPSWETLPHERLSPSADTVGRRVEVLRRLA
RPDDRSYGAPLQVIVTTVRSLVQPMAPGLGEIEPVTLRVGVEHDFDGLIQRLVEMAYTRV
DMVGKRGEFAVRGGILDLFSPTADHPVRVEFWGDEVTELRAFSVADQRSLPELDIDAVIA
PPCRELLLTEDVRDRAAQLAVDNQADAALVEMLDKMSAGIPVEGMEALLPVLRPGQLQLL
TDVLPESAHVLLCDPEKIRTRATDLVRTGQEFLEASWTAASIGGAVPLDTSVLKGDGIDL
GASAYRSLSQVRESAETTGLPWWTLSPLASGNGEELELAVTPAPQVRGSDDLLSELFVSL
RAHVTTGGRAVIVVAGAGTAHRVLERLREAEVPAAELAPGTEPPRGQVGVLRGSLHDGLV
FPGDASTAGLVIVTEADLTGNRVAAVGDGKRLPAKRRNQVDPLALTAGDMVVHDQHGIGR
FVEMVERTIGGARREYLVIEYAASKRGHPGDRLFVPMESLDQLSRYVGGELPALSKLGGS
DWANTKRKARKAVREIAGELVQLYAARQAAPGHAFGPDTPWQKEMEDAFAFTETHDQLTV
ISEVKADMEKAVPMDRVVIGDVGYGKTEIAVRAAFKAVQDGKQVAVLVPTTLLAQQHLQT
FTERMAAFPVTVRGLSRFTDAGDSKEIIAGMADGEIDVVVGTHRLLQTGIRWKDLGLVIV
DEEQRFGVEHKEHIKALRTHVDVLTMSATPIPRTLEMSMAGIREMSTILTPPEERHPILT
YVGAYADKQVAAAIRRELLRDGQVFYVHNRVSSIDKSAQRIRDLVPEARVVVAHGQMNED
TLERTVQGFWERDYDVLVCTTIIETGLDISNANTLIVERADSLGLSQLHQLRGRVGRSRE
RGYAYFLYPPEKPLTETAYDRLATISQNSDLGAGMAVAMKDLEIRGAGNVLGAEQSGHVA
GVGFDPLRAAGGGGGRGVPGGRRRQADHDGGRPEGGPYRPARRRAHPSRLRHQRPSPARG
IPQARGGHRTRRHHGRGRRTRRPVRTAPRGGPPTGFGGQAAPAGPRVRTRGNRRGRDAAE
DRADGPARLEAVASQADLPERAVPCHHRDGAAAAAPGRFRRNRRGAGAGRGVAAVHRRFR
ARAGRQGCRVRGDGGLTDDGGPARPVAAHDDPDAGGRGGR
NT seq 3723 nt   +upstreamnt  +downstreamnt
ttgtcttccccgctcatcgctgccgagccctcgtccgacaccccgctcgccggtctggcg
aagatcgcgctgggcgacgcagtcatcgcgcaggtgaccgaggcgctcgggcggcatcac
ctcgacatcgtcgcgcccgcacccgcccggccgttcgtggccgcggctctcgccgagcgc
acccatctgctgctggtcaccgcgaccggtcgcgaggccgacgacctgaccgccgaactg
caggagatgatcggcgacgccgttgcgcagttcccgtcgtgggagacgctgccgcacgaa
cggctgtcgccgagcgccgacacggtcggtcgccgcgtggaggtgctccgcagactcgcg
cgcccggacgaccgctcgtacggggccccgctccaggtcatcgtcaccaccgtccgttcg
ctggtgcaacccatggcccccggtctcggtgagatcgaaccggtaacgctgcgcgtgggt
gtcgagcacgacttcgacgggctgatccagcggctcgtcgaaatggcgtacacgcgcgtc
gacatggtgggcaagcgcggcgagttcgccgtccgcggcggcatcctggacctgttctca
cccaccgcggatcatcccgtgcgcgtcgaattctggggcgacgaggtcaccgagttgcgc
gcgttctccgtcgcggatcagaggtcgctgcccgaactcgacatcgacgccgtcatcgcc
ccgccgtgccgcgaactgctcctcaccgaggacgtccgcgaccgcgccgcgcagctcgcg
gtcgacaaccaggccgacgccgcgctcgtcgagatgctcgacaagatgtcggccggcatc
ccggtggagggcatggaggcactgctgcccgtgctgcggccggggcaactccagttgctc
accgacgtgctgcccgagagcgcacacgtgctgctgtgcgatccggagaagatccggacg
cgcgccaccgacctggtgcgcaccggtcaggagttcctcgaggcgtcgtggacggcggcc
tcgatcggcggcgccgtcccgctcgacacctcggtgctgaagggcgacggcatcgacctc
ggcgcctccgcctaccgctcgctcagtcaggtccgggaatccgcggagaccacgggtctg
ccgtggtggacgctgagcccgctcgcgtccggcaacggcgaggaactggagctggcggtc
acgccggcaccccaggtccgcggttccgacgacctgctgtcggaactgttcgtgagcctg
cgcgcccacgtcaccaccggcgggcgggccgtcatcgtggtcgcgggcgccggcaccgcg
catcgcgtgctcgagcgtcttcgcgaggccgaggtacccgcggcggaactcgcgcccggt
accgagcccccgcggggccaggtcggggtgctccgcggttcgctccacgacggcctggtc
ttccccggcgacgcctccaccgccggactcgtcatcgtcacggaggccgacctcaccggc
aaccgggtggccgcggtcggcgacggcaagaggctgccggcgaagcgccgcaaccaggtg
gacccgctcgctctgaccgccggggacatggtggtgcacgaccagcacggcatcggacga
ttcgtcgagatggtcgaacgcaccatcggcggcgcgcggcgcgagtacctcgtgatcgag
tacgccgccagcaagcgcggacacccgggcgaccgtctgttcgtcccgatggagtcgctc
gaccagctgtcgcggtacgtcggcggcgagctgcccgcgctgagcaagctcggcggttcc
gactgggccaacaccaaacgcaaggcgcgcaaggcggttcgtgagatcgccggtgaactc
gtccagctgtacgcggcgcggcaggccgcacccggtcatgcgttcggcccggacaccccg
tggcagaaggagatggaggacgccttcgcgttcaccgagacccacgaccagctgacggtc
atcagcgaggtcaaggccgacatggagaaggcggtcccgatggaccgcgtcgtcatcggc
gacgtcggctacggcaagaccgagatcgcggtgcgggcggcgttcaaggccgtgcaggac
ggcaagcaggtggcggtcctggtgccgacgaccctcctcgctcagcagcacctgcagacg
ttcaccgagcgcatggcggcgttcccggtgacggtgcgcgggctctcccgcttcacggat
gcgggggactccaaggagatcatcgccggcatggcggacggcgagatcgacgtcgtggtc
ggcacgcaccggctgctgcagaccgggatccggtggaaggacctgggcctcgtcatcgtc
gacgaggaacagcgcttcggtgtggaacacaaggagcacatcaaggcgctgcgcacccac
gtggacgttctcacgatgtcggccacgccgatcccgcgaacgctggagatgagcatggcg
ggcatccgcgagatgtccacgatcctcacaccgccggaggagcggcaccccatcctcacc
tatgtcggcgcgtacgccgacaagcaggtcgccgcggccatccgacgggaactgctccgc
gacgggcaggtgttctacgtccacaaccgggtcagctcgatcgacaagtcggcccagcgt
atccgcgacctcgtccccgaggcgcgggtcgtggtggcgcacggccagatgaacgaggac
acgctcgagcggaccgtgcagggcttctgggaacgcgactacgacgtgctggtgtgcacc
accatcatcgagacgggtctcgacatctccaacgccaacacgctcatcgtcgaacgcgcc
gattccctcggcctgtcgcagctgcaccagttgcgcggtcgcgtcgggcgtagccgggaa
cgcggctacgcgtacttcctgtacccgccggagaagccgctcacggagacggcctacgac
cgcctcgcgaccatttcgcagaactccgacctcggtgccggcatggcggtcgcgatgaag
gacctcgagatccgcggcgccggaaacgtgctgggcgccgagcagtccggtcacgtcgcg
ggtgtcgggttcgatcctctacgtgcggctggtgggggaggcggtcgaggcgttccgggc
ggccgccgacggcaagccgatcacgacggaggacgccccgaaggaggtccgtatcgacct
gcccgtcgacgcgcacatccctcccgattacgtcaccagcgaccgtctccggctcgaggg
ataccgcaagctcgcggcggccaccgaactcgacggcatcacggccgtggtcgacgaact
cgtcgaccggtacggaccgctccccgaggaggtccgccgactggtttcggtggccaagct
gcgcctgctggcccgcgagtacggactcgaggaaatcgccgtggtcgggacgcagctgaa
gatcgcgccgatggccctgcccgactcgaagcagttgcgtctcaagcggatctacccgag
cgcgcagtaccgtgccaccaccgggatggtgcagctgccgctgccccgggcaggttccgg
cggaatcggcgcggagcgggtgcgggacgtggagttgctgcagtacatcgccgatttcgt
gctcgcgctggacggcaaggctgccgggtccgtggtgatggaggcctgaccgatgacggt
ggtcctgctcgacccgttgcggcccacgacgatcccgatgcaggcggtcggggtggtcgg
tga

DBGET integrated database retrieval system