KEGG   Rhodococcus opacus PD630: Pd630_LPD02495
Entry
Pd630_LPD02495    CDS       T03071                                 

Definition
(GenBank) Exodeoxyribonuclease 7 large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Pd630_LPD02495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02495
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Pd630_LPD02495
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     Pd630_LPD02495
SSDB
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon Peptidase_S66
Other DBs
NCBI-ProteinID: AHK29718
LinkDB
Position
complement(2642021..2643205)
AA seq 394 aa
MSAKVAQWIDRLGSVWVEGQITQINARPGTRTAFLVLRDPSVDMSLSVTCSPQLLQNSPV
PLTEGSRVVMFGKLSFYTGRGSVSLRVTEIRAIGIGELLARIERLRALLAAEGLFDPRLK
RPLPFLPGTIGLITGRASAAEHDVLSVAQRRWPAVRFEVRNTPVQGATAVPQILDALKEL
DADPHVDVIILARGGGSVEDLLPFSDETLCRAIVACRTPVVSAIGHEPDSPLSDHVADLR
AATPTDAAKRVVPDAVAEQALVGELRSRSAAALRNWVQRESHLIAQLRSRPVLADPLRAL
DHRSDEVERLREAGRRDISRAIAAESTTIEHLRARLTTLGPAATLARGYSVVQRIVPDGD
PEVLRSVDDAPPGTQIRVRVADGAIRAAVMGKDK
NT seq 1185 nt   +upstreamnt  +downstreamnt
gtgtcggccaaggtcgcacagtggatcgaccggctcgggagtgtctgggtcgagggacag
atcacccagatcaacgcgcgtccgggaacccggaccgcgtttctggtgctgcgggacccg
tccgtcgacatgtcgttgtcggtgacctgctccccacagctgttgcagaactcccccgtc
ccgctcaccgagggcagccgggtggtgatgttcggcaagttgtcgttctacaccggccgc
gggtcggtctcgctgcgggtgacggagatccgcgcgatcgggatcggtgaactcctcgcc
cggatcgagcggctgcgtgcgctgctcgcagcggagggcctgttcgaccctcggctgaag
cgtccgctgccgttcctgccgggcaccatcgggctgatcaccggtcgcgccagcgccgcc
gagcacgacgtcctcagtgtggcgcagcgccgctggcccgccgtgcgcttcgaggtgcgc
aacaccccggtgcagggcgcgaccgccgttccgcagatcctcgacgcgttgaaggaactg
gacgccgacccgcacgtcgacgtgatcatcctcgcgcgcggcgggggcagtgtggaggat
ctgctgccgttctccgacgagacgctgtgccgcgcgatcgtcgcctgccgaactccagtg
gtcagcgccatcggtcacgagccggacagtccgctcagcgatcacgtcgccgacctgcgg
gccgcgacaccgacggacgccgccaagcgggtcgtaccggacgccgtcgccgagcaggcg
ctggtcggcgaactgcggtcgcggagcgcggctgcgctgcgcaactgggtgcagcgcgag
tcgcacctgatcgcccagctgcggagccggccggtgctcgccgatccgctgcgcgcactc
gaccaccggtcggacgaggtcgagcgactgcgggaggcggggcgacgcgacatcagccgg
gcgatcgccgcggagagcaccacgatcgagcaccttcgtgcacggctgacgaccctcggc
cccgccgcgaccctggcccgcggctactccgtggttcagcggatcgtgcccgacggcgat
cccgaggtactgcgttcggtcgacgacgccccaccgggcacccagattcgcgttcgagtc
gccgacggcgcaatccgtgccgcggtgatgggaaaggacaagtag

DBGET integrated database retrieval system