KEGG   Rhodococcus opacus PD630: Pd630_LPD02501
Entry
Pd630_LPD02501    CDS       T03071                                 

Definition
(GenBank) Nuclease sbcCD subunit D
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02501
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD02501
SSDB
Motif
Pfam: Metallophos Metallophos_2 SbcD_C
Other DBs
NCBI-ProteinID: AHK29724
LinkDB
Position
2647286..2648470
AA seq 394 aa
MRILHTSDWHIGRTFHGVDLLTDQARVLDAIAALVAEHGVDVVVVPGDVYDRSIPSADAV
TVCNRGFEAIRDAGAVIVATSGNHDSAARLGAGAAFSRAGGLHLMTTVAGIGSPVVLEDA
HGPVAFYGIPYLEPEITRTQLDVPTARSHAEILDAAMDRVRTDLDRRNDTTPLTRSVVLA
HAFVVGAEATGSERSISVGGVETVSASAFGGVDYVALGHLHSPQTLAENIRYSGSPLPYS
FGERTHSKAVYLVDLDADGLRTVERVDLPVVRGLRQLTGTVQELLEDDTYRDAEDCYVSA
VLTDPERPVDAMRSLQTRFPFAVHLEWQRPEGGDDLRYRDKVHGRSDLQITRSFLTDVRS
EPSTGEIRLVEAALGFADRAGEDTAEVVALEQTA
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaggatcctgcacacttcggactggcacatcggacgcacgttccacggggtggacctg
ctcaccgaccaggcccgtgtgctcgacgcgatcgccgccctcgtcgccgagcacggcgtg
gacgtcgtcgtcgttcccggtgacgtgtacgaccggtcgatccccagcgcggacgccgtc
accgtgtgcaaccgcggcttcgaagcgatccgggacgccggcgcggtgatcgtcgccacg
tccggcaaccacgactccgcggcgcggctcggggcgggtgccgcgttctcccgcgcgggc
gggctgcacctcatgacgacggtcgccggcatcggctcgcccgtcgtgctcgaggacgcg
cacggtcccgtcgcgttctacggcattccctatctcgagcccgagatcacccgcacgcaa
ctggacgtgccgaccgcgcggtcacacgccgagatcctcgacgccgcgatggaccgtgtc
cgcaccgacctcgacaggcggaacgacaccacaccgctcaccaggtccgtggtgctggcc
cacgcgttcgtggtgggagcggaggccaccgggtcggagaggtccatctccgtcggcggc
gtcgagacggtgtcggcttcggccttcggcggggtcgactacgtcgcgctcggccacctc
cactcgccgcagaccctcgcggagaacatccggtactcgggttcgccgctgccgtactcc
ttcggcgagcgcacccacagcaaggcggtctacctcgtggatctcgacgccgacggactg
cggaccgtcgagcgggtcgacctgccggtggtccgcggtctccgacaattgaccggcacg
gtgcaggagttgctcgaggacgacacgtaccgcgacgccgaggactgctacgtgtcagcg
gtgctcaccgacccggaacgcccggtcgacgccatgcgctcactccagacccgattcccg
ttcgccgttcacctcgagtggcaacgccccgagggcggcgacgatctgcgctaccgcgac
aaggtgcacgggcgcagcgatctgcagatcacgcgcagcttcctcaccgacgtgcgcagc
gaaccgtcgaccggcgagatccggctggtggaagctgcactcggcttcgccgaccgggcc
ggcgaagacaccgccgaggtcgtcgcgctggaacagacggcatga

DBGET integrated database retrieval system