KEGG   Rhodococcus opacus PD630: Pd630_LPD02502
Entry
Pd630_LPD02502    CDS       T03071                                 

Definition
(GenBank) Nuclease sbcCD subunit C
  KO
K03546  DNA repair protein SbcC/Rad50
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02502
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD02502
SSDB
Motif
Pfam: AAA_23 SbcCD_C AAA_27 AAA_29 SMC_N CEP63 AAA_22 AAA_15
Other DBs
NCBI-ProteinID: AHK29725
LinkDB
Position
2648467..2651448
AA seq 993 aa
MRLHRLEVEAFGPFAGSVEVDFDRLGADGLFLLHGHTGAGKTTVLDAVAFALYGTVPGAR
KDGKRLLSDHAPAGSVPTVTLEATIAGRHLRLVRSPEFERPKRRGSGTIKENAKATLTWL
DGRGENLSRIPDIADEVGRLMGMSADQFFQVVLLPQGEFAKFLRADNEERGQLLERLFDT
TRFGTVEEWFLDRRRTSAHDLDEHQRAIDVLLARVATAAGIEGGADADPVTWAHKLEDEA
RETRDLAADDLQNAKSRAKMARDALTEARRVLELQNRRRRAEAELEAHAAGAGRRAVLVA
ELADARRAEPVATVARDADAARAKAAAAARNVEAITDGLRSTAGGADLVAELSWPPTADE
REHIRSSIRAWRDEIVRLDGALAESVAADRLAVEVERLRARQVELAEAGDALSREREQLP
LALREAEKALDSAQKARAALPALVDARDRAADAASAAADLRTRRTERDRLDRGVLDARRK
HQDAREHWLDLLQRRIAGMAAELAGTLEDGVPCQVCGSPEHPQPAEPSELSVTKADEDKA
LAAEQKAAAALTTATEKLGAVERAIDVLVQRGGDGDADELAQALTAAETAMGEATALGDE
VERRSASLTELRDRESHLQERSREVGVDAATVAERITASATQLGEIRARVSEAAGDDPSV
EARRGRLDALAESASELLDARDAGAGAESAARELAAKAETLAGDAGFDGTAGAVTAVRTP
ARQREIEAVLTAARDAEVGARSVLDDPEIVAVAETEPVELASVQHAHDAAAEVVNVTVAA
ASDAERRLLDLERFVGQLDKAAEAIAPMQAAHEELAALAEVIAGRGQNARKMSLRSYVLA
ARLEEVAVSASARLGRMSAGRYEFVHSDEAGPRGRRGGLGLDIRDDYTGVVRSAKTLSGG
ESFLASLSLALGLADVVAAESGGVVLDTMFIDEGFGTLDADTLDSVMGVLDELRDGGRVV
GIVSHVDEMRQRIPSRLHVIRGRTGSTVEVVAG
NT seq 2982 nt   +upstreamnt  +downstreamnt
atgaggctgcatcgactcgaggtcgaagccttcgggccgttcgcaggatccgtggaagtc
gacttcgatcggctcggcgcggacgggctctttctgctgcacgggcataccggagccggt
aagacgacagtcctcgacgcggtggcgttcgcgctgtacggcacggtgcccggggcacgg
aaggacggcaagcgcctcctgtccgaccacgcgcccgccggttccgttccaacggtgacg
ctcgaggcgacgatcgcgggccggcatctgcgtctcgtccgcagcccggagttcgagcgt
cccaagcgccgtgggtcggggaccatcaaggagaacgcgaaggccacgctcacctggctc
gacggccgcggggagaacctgtcacgcatccccgacatcgccgacgaggtcgggcggctg
atgggcatgagcgccgatcagttcttccaggtggtcctgctgccgcagggggagttcgcg
aagtttctgcgcgccgacaacgaggaacgcggtcagctcctggagaggctgttcgacacc
acccgattcgggacggtggaggagtggttcctcgaccgcaggcgcaccagcgctcacgac
ctggacgagcatcaacgggccatcgacgttctgctggcacgggtcgcgacggccgcgggc
atcgagggaggcgctgatgccgatccggtgacctgggcccacaagctcgaggacgaggcc
cgcgagacccgtgacctggctgcggacgacctgcagaacgccaagagccgggcgaagatg
gcccgcgacgcgctcacggaggcgcgccgcgtcctcgaactccagaaccgcaggcggcga
gccgaggcggaactcgaggcccacgcagcgggggcaggccggcgggcggtcctggtcgcc
gaattggcggatgcgcgccgggccgaaccggtcgcgaccgtcgcgcgcgacgccgacgcc
gcccgggccaaggctgcggctgcggcacggaacgtcgaggcgatcacggacggattgcgc
tcgacggcaggcggcgccgatctcgtggcggagttgtcctggcctccgaccgctgacgaa
cgggagcacatccggtcgagtatccgggcctggcgtgacgagatcgtgcgcctcgacggg
gctctcgccgaatccgtcgccgccgaccggctcgctgtcgaagtggagcgactgcgcgcc
cggcaggtcgaactcgccgaggccggtgacgcgctgtcccgggagcgggaacaattgccg
ctcgccctgcgggaagcggagaaggcgctcgactcggcgcagaaggcccgcgccgcactg
cccgctctcgtcgatgcccgggatcgggcagccgacgctgcctcggcggcagcggatctc
cgtacccgccgcaccgagcgcgatcggctcgaccgcggcgtgctcgacgctcggcggaag
catcaggacgcgcgggaacactggctcgacctgctgcaacgtcggatcgcgggcatggca
gccgaactggcgggcacgctcgaagacggtgtcccgtgccaggtgtgcggttcacccgag
cacccgcagcctgccgaaccgtccgagctgtcggtcacgaaggccgacgaggacaaggct
ctcgccgcggagcagaaggccgcggcggcgctgacgaccgcgaccgagaaattgggcgcg
gtggagcgcgcgatcgacgtgctcgtccagcgcggcggcgacggtgacgcggacgaactc
gcgcaggcactcacggccgcggagacggcgatgggggaggcgaccgcgctcggcgacgag
gtcgagcgtcggtccgcatcgctcaccgagctgcgggaccgcgagagtcacctgcaggaa
cggtcgcgggaggtgggcgtcgacgccgccaccgtggccgagaggatcactgcgagtgcg
acacagctcggggagatccgggcccgggtgagcgaggcggcaggcgacgacccgagcgtg
gaggctcgtcgcggacgactcgacgccctcgccgagtccgcatccgagctgctcgacgcg
cgggacgccggtgccggagccgagtcggcggcccgtgaactcgcggccaaggccgaaaca
ctcgccggggacgccggtttcgacggcactgccggcgccgtgaccgcggtccggacgccc
gcccgccagcgtgagatcgaggccgtgctcacggcggcgcgggacgccgaggtcggggcg
cgcagcgtgctcgacgaccccgagatcgttgccgtcgccgagacggagcccgtggaattg
gcgtccgtccagcacgcgcacgacgcggccgcggaggtcgtgaacgtcaccgtcgcggcg
gcgtccgacgccgagcgccgactgctcgatctggaacggttcgtcggtcagctcgacaag
gccgccgaggcgatcgcgccgatgcaggccgcgcacgaggagctggccgcgctcgccgag
gtgatcgcgggccgtggccagaacgccaggaagatgtcgctgcggtcgtatgtgctggcg
gcccggctggaagaggttgcggtgtcggcatccgcgcggctcggccggatgtcggcggga
cgttacgagttcgtccacagcgacgaggcgggtccgcgaggccgccgcggtggtctggga
ctggacatccgcgacgactacaccggggtggtgcggtcggccaagaccctgtccggcggt
gagtcgttcctggcgtcgctgtcgctggcgctcggtctcgccgatgtggtcgccgcggag
tcgggaggcgtcgtcctcgacacgatgttcatcgacgaaggattcggcaccctcgacgcg
gacaccctcgactcggtgatgggcgtgctcgacgagcttcgtgacggcggccgggtggtc
gggatcgtcagtcacgtcgacgagatgcgtcagcgaatcccgagccggctgcacgtgatt
cgcggacgcaccggctccaccgtggaggtggtcgccggctga

DBGET integrated database retrieval system