KEGG   Rhodococcus opacus PD630: Pd630_LPD02608
Entry
Pd630_LPD02608    CDS       T03071                                 

Definition
(GenBank) putative GMP synthase [glutamine-hydrolyzing]
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pd630_LPD02608
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02608
Enzymes [BR:roa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     Pd630_LPD02608
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pd630_LPD02608
SSDB
Motif
Pfam: Adenine_glyco HhH-GPD
Other DBs
NCBI-ProteinID: AHK29831
LinkDB
Position
2778664..2779218
AA seq 184 aa
MRCEWAVDTDGSRLYRDYHDLEWGRPLHGRDELYERLCLEAFQSGLSWITILRKREAFRA
AFAGFDPEAVAQYTERDVARLLEDASIVRNRAKIEASVSNARALLELSDTDLDTLLWSFA
PPPRPSRLATVNDVPAVTPESTAMAKELKRRGFKFVGPTTAYALMQATGMVDDHVAACWV
PLTA
NT seq 555 nt   +upstreamnt  +downstreamnt
gtgcggtgcgagtgggcggtcgacacggacgggtcccggctgtaccgggactaccacgac
ctcgagtggggtcgtccgctgcacggccgcgacgagttgtacgagaggctgtgcctcgaa
gcgttccagtcgggactctcgtggatcacgattctccgcaagcgcgaggccttccgggcc
gcgttcgccgggttcgatccggaggcggtggcccagtacacggaacgcgacgtggcgcgc
ctgctcgaggacgcgtcgatcgtgcggaaccgggccaagatcgaggcgtcggtgagcaat
gcgcgggccctcctggagttgtcggacaccgacctcgacaccctgctgtggtcgttcgcc
ccgccgccgcgcccgagccgcctcgccaccgtgaacgacgtcccggccgtcacaccggag
tccaccgcgatggcgaaggaattgaagcgccgagggttcaaatttgtgggccctaccact
gcttatgcactcatgcaggccaccgggatggtggacgaccacgtggccgcctgctgggtc
ccgctcactgcctga

DBGET integrated database retrieval system