KEGG   Rhodococcus opacus PD630: Pd630_LPD02830Help
Entry
Pd630_LPD02830    CDS       T03071                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00473  D-Alanine metabolism
roa01100  Metabolic pathways
roa01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Pd630_LPD02830
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Pd630_LPD02830
Enzymes [BR:roa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Pd630_LPD02830
Peptidoglycan biosynthesis and degradation proteins [BR:roa01011]
 Precursor biosynthesis
  Racemase
   Pd630_LPD02830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHK30053
UniProt: W8HAH8
LinkDB All DBs
Position
3035496..3036701
Genome map
AA seq 401 aa AA seqDB search
MTLAEAVPADDHGHSEPAAPAQAAPAPQAEAVVDLDAIAHNVRILRDSARDAAMMAVVKA
DGYNHGAVPVARAALAAGASELGVTTVSEALTLRRAGIDAPVLAWLHTVDADFAPAIAAG
VELGVSSPRHLAAVVAAARSVGVTAIVTIKVDTGLNRNGVAPDELAQVLVDLARAQAEGS
VRLRGIFSHLAHADEPHHAWIDSQRDRLVSAIADAKRQGLIPEVVHLSNSAATLTRPDLR
FDMVRPGIAIYGLSPVPELGQFGLRPAMTLRSRVALVKKVAAGEGVSYGHQWVAPRDTTV
ALLPFGYADGLPRSLSGRFEVQLGAERRPGIGRVCMDQVVVDLGPDGGGVREGDTAVFFG
NGDLGEPIAQAWADELDTIHYEVVTGVRGRTVRSYVGGTGT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgctgaagcagtaccggccgacgaccacggacacagcgaacccgcagcgccc
gcacaggcggcgccggcaccgcaggccgaggccgtggtcgatctggacgcgattgcgcac
aacgtccgcatcctgcgcgacagtgcccgggacgcggcgatgatggccgtcgtgaaggcg
gacggctacaaccacggcgcggtgcccgtggcacgcgcagcgctggccgccggagcgtcg
gaactgggcgtgacgacggtgtcggaggcgctgactctgcgccgcgcgggcatcgacgca
cccgtcctcgcctggctgcacaccgtcgacgccgatttcgcccccgcgatcgcggccggc
gtcgaactcggcgtgtcctcgccgcgtcacctcgccgcggtggtcgcagccgcccggagc
gtcggtgtcacggcgatcgtcacgatcaaggtcgacaccggactgaaccgcaacggggtg
gcacccgacgaactggcgcaggtcctcgtcgatctggcgcgcgcacaggccgagggctcg
gtgcggctgcgcggcatcttctcgcatctcgcccacgccgacgagccgcaccacgcctgg
atcgattcccagcgcgaccgactggtcagcgcgatcgcggatgccaagcgtcagggactg
atccccgaagtggtgcacctgtccaattccgcggccaccctgacccgtcccgacctgcgg
tttgacatggttcgcccgggaatcgcgatatatgggttgtcgcccgtacccgaactcggt
cagttcgggttgcgcccggcgatgacactgcgatcgagggtggctctggtgaagaaggta
gcggcaggtgaaggcgtgtcctacgggcaccagtgggtggccccacgggatacgacggtg
gcgctgctgccgttcgggtacgcagacgggctcccgcgctcgctcagcggccgtttcgag
gtccagctgggcgcggaacgacggccggggatcgggcgtgtgtgcatggaccaggtggtc
gtcgatctcggaccggacggcgggggagtccgggagggggacaccgcggtgttcttcggc
aacggagatctcggcgagcccatcgcgcaggcgtgggccgacgaactcgacaccatccac
tacgaggtggtgacgggggtacgcggacgcacggtgcgcagttacgtcggcggaacgggt
acgtag

DBGET integrated database retrieval system