KEGG   Rhodococcus opacus PD630: Pd630_LPD02864
Entry
Pd630_LPD02864    CDS       T03071                                 

Definition
(GenBank) DNA polymerase IV
  KO
K14161  protein ImuB
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02864
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD02864
SSDB
Motif
Pfam: IMS
Other DBs
NCBI-ProteinID: AHK30087
LinkDB
Position
3068051..3069604
AA seq 517 aa
MSRVLALWCPDWPAVAAAAAADLPPTHPVAVTSGNRVIACSAPARADGVRRGLRRRESQA
RCPRLHVVAADPDRDARLFEPVASAVDAVAPGVEVLRPGLVVLSARGVARYFGSEEAAAE
RLVDQVSAVGVECQVGIADELSTAVIAARRATLVPPGEGSAFLAPLPMRELAAEPSLAAP
HRGELVDLLHRLGLRTIGSFAALSAGDVASRFGTDAVLAHRAARGEPERPPSGRSLPPDL
EVEERCDPVIERVDAAAFAGRALAEKLHRTLSDAAVACTRLSISASTGNGEQLSRIWRCA
EPLTPEATADRVRWQLDGWLTGRSEKRPTAGIAVLRLEPVEVVAAGALQLGLWGGVGDQD
ERARRALVRVQGLLGGEAVQVGVLSGGRGPAERITLLPLGDELIPRNDPSEPWPGTLPEP
APAAVLTAYPEVWMSDERGMAVTVTERGVFSAPPARLRWGSREWAVCGWAGPWPVDERWW
DPPAARTAARAQVLLEESRALLVICTAGRWSVEGIYE
NT seq 1554 nt   +upstreamnt  +downstreamnt
gtgagccgggtgctggcgttgtggtgccccgactggcccgcggtcgcggcggctgctgct
gcggacctcccgccgacgcatccggtggcggtgacgtcgggcaatcgggtgatcgcctgc
tcggcgccggcccgcgcggacggggtgcgcagagggctgcgccgccgcgagtcccaggcc
cggtgcccccggttgcacgtggtggcagccgatcccgaccgcgacgcgcggctgttcgag
ccggtcgcctcggccgtcgacgcggtggcgcccggtgtcgaggtgctgcgacccgggctc
gtggtgctgtccgctcggggcgtcgcccggtacttcggttcggaggaagccgccgcggaa
cggttggtggaccaggtgtcggcggtgggggtggagtgccaggtcggtatcgccgatgag
ctgtccacggccgtgatcgccgcgcgcagagcaactctcgtgccacccggtgaggggtcc
gccttcctggcgccgctcccgatgcgggaactggccgccgagccgagcctcgcggcacct
caccgcggtgagctggtcgatctgctgcaccggctcgggttgcgcacgatcggcagtttc
gccgcgctgtcggcgggcgatgtggcttcgcggttcggaaccgatgctgtgctggcgcat
cgggccgcgcggggtgagccggagcgccccccgtcggggcggtcgctgcctcccgacctg
gaggtcgaggaacggtgcgatcccgtcatcgaacgggtcgacgccgctgccttcgcgggg
cgtgcgctggcggagaagcttcatcgcacactgtcggacgccgcggtggcctgcacccgg
ctgtcgatctcggcgagcaccggcaacggtgagcaactgtcccggatctggagatgtgcg
gaaccgttgacgccggaggcgacggcggaccgggtgcggtggcagctggacgggtggctg
accgggcgcagcgagaagcggcccaccgccggtatcgccgtcctgcggctcgaaccggtg
gaagtggtggcggccggagccttgcagctggggctgtggggtggggtcggcgaccaggac
gagcgggcccggcgggctctggtgcgggtgcagggcctgctcgggggggaagccgtgcag
gtgggggtcctcagcggtgggcggggcccggcggagcgcatcacgttgctgccgttgggc
gacgagttgattccgcgcaacgatccgtcggagccgtggccgggcacgttgccggaaccg
gcacctgccgcggtgctgaccgcgtatccggaggtgtggatgtcggacgagcggggtatg
gctgtgacggtcacggaacgtggtgtgttcagcgcgcctcccgcgcgattgcggtggggg
agccgagagtgggcggtgtgcggatgggccggaccgtggccggtggacgagcggtggtgg
gaccctccggccgcccggacggcggcccgggcccaggtgctgctggaagagtcgcgggcg
ctgctggtgatctgcacggcaggccgatggtcggtggagggaatctatgagtga

DBGET integrated database retrieval system