KEGG   Rhodococcus opacus PD630: Pd630_LPD02878
Entry
Pd630_LPD02878    CDS       T03071                                 

Definition
(GenBank) Error-prone DNA polymerase
  KO
K14162  error-prone DNA polymerase [EC:2.7.7.7]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02878
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pd630_LPD02878
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD02878
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon HHH_3 HTH_Tnp_1 DUF3161
Other DBs
NCBI-ProteinID: AHK30101
LinkDB
Position
3082975..3086229
AA seq 1084 aa
MGWGNGPPTWSEMERVLSGRPGRVSPESLYPGDGGDSPAWSRKRGEYRAGRQERAGSTVP
YAELHAHSAFSFLDGASPPEELVEEAVRLGLEAIALTDHDGFYGVVRFAEAAKELNMRTV
FGSELTLDDAHLLVLARGQEGYRRLSREIAAAHLAGGEKGKLRYDLDRLTDAAGGHWQIL
TGCRKGHVRQALADGGPDAAAARLRELIDRFGADRVTVELTHHGIAEDGERNADLAELAQ
QHGLRVIASTAAHFAGPPRRRLAMAMAAVRARQSLDDAAGHLAPAGGAHLRSGEEMAHLF
AAYPEAVRGAAHLGLECAFDLRLIAPQLPPFDVPDGHTEASWLRQLTMDGARRRYGAPAD
RPEAYRQIEHELDIITGLNFPGYFLVVHDIVSFCKNNDILCQGRGSAANSAVCYAIGITN
VDPVRNKLLFERFLSPERDGPPDIDVDIESDRREEAIQHVYAKYGRQYAAQVANVITYRG
KSSVRDMARALGFSQGQQDAWSKQVSRWGGIGKEVGTDIPPAVLELAAQIEGFPRHLGIH
SGGMVICDRPIADVCPVEWARMENRSVLQWDKDDCAAVGLVKFDMLGLGMLSALHYMIDL
VAEHKGIEVDLAQLDLSEEAVYEMLQRADSVGVFQVESRAQMATLPRLKPRNFYDLVVEV
ALIRPGPIQGGSVHPYIRRRNKLEPVTYDHPSLEKALKRTLGVPLFQEQLMQMAVDVAGF
SPAEADQLRRAMGSKRSPEKMERLRGRLYQGMREMHGIGDDVADRIYEKLYAFANFGFPE
SHSQSFAALVFYSSWFKLHHPAAFCAGLLRAQPMGFYSPQSLVADARRHGVQVHGADINA
SLAHATVEAGGTEVRLGLGEVRHIGTALAERIVESRGDGGPYTSFLDLTGRVELSTAQAE
SLATAGALDSFGLSRREALWAAGAAAGERRDRLPGIGASTRAPTLPGMSDLELAAADVWA
TGVSPDTYPTQFLRPQLDALGVVPAAHLLDVPDGDRVLVGGAVTHRQRPATAAGVTFINL
EDETGMVNVVCSVGLWAKYRKLANTAPALLVRGKVQNAEGAVTVVADRLQLMDLRVSAKS
RDFR
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgggttggggaaacggtccgccgacgtggtccgagatggagcgcgtcttgtcgggcagg
ccggggcgggtcagcccggagtcgctgtatccgggcgacggcggggacagccccgcgtgg
tcccgcaagcggggggagtaccgggcgggccgtcaggagcgcgccggctccaccgttccg
tacgccgaactccacgcgcactcggcgttcagtttcctcgacggtgcctccccgccggaa
gagttggtggaggaggccgtccggctcggtctcgaggccatcgcactcaccgaccacgac
gggttctacggtgtggtccggttcgcggaggcggcgaaggaactgaacatgcgcaccgtg
ttcgggtccgaactgacgttggacgacgcgcatctgctggtactggcgcgaggtcaggag
gggtaccggcggctctcccgggaaatcgcggcggcgcatctcgcgggcggggagaagggc
aagctgcgctacgacctcgaccgtctcaccgacgcggccggggggcactggcagatcctg
accgggtgccggaaggggcatgtgcgtcaggcgctggccgacggtggcccggacgccgcg
gccgcccggctgcgggagctgatcgaccggttcggggccgaccgggtcacggtggaactc
acccatcacggcatcgcggaggacggtgagcgcaacgccgacctcgccgaactcgcacag
cagcacggacttcgggtgatcgcgtccacggcggcgcacttcgcgggaccgccgcgccgg
aggctggccatggcgatggccgcagtccgggcccggcagagcctcgacgacgcggccggg
cacctggcgcccgccgggggagcgcacctgcggtccggtgaggagatggcgcacctcttc
gccgcatacccggaagccgtgcgcggtgccgcgcacctcgggctggagtgtgcgttcgac
ctgcggctcatcgcgccgcaactgccaccgttcgacgtgcccgacgggcacaccgaggcg
agctggctgcggcagctcacgatggacggggcgcgccgccgttacggtgcgccggcggac
cgcccggaggcctaccggcagatcgagcacgaactggacatcatcaccgggctgaacttc
ccgggctacttcctggtggtccacgacatcgtgtcgttctgcaagaacaacgacattctc
tgccagggaaggggttcggcggccaactccgccgtctgctacgccatcggcatcaccaac
gtggatcccgtccgcaacaaactgctgttcgaacgtttcctctcgcccgaacgcgacggc
ccgccggacatcgacgtcgacatcgaatccgatcggcgggaggaggccatccagcacgtc
tacgccaagtacggccgccagtacgcggcgcaggtggcgaacgtcatcacgtaccgcgga
aagtcctcggtgcgggacatggcccgggcgctgggtttctcgcaggggcagcaggacgcg
tggagcaaacaggtcagccgctggggtggcatcgggaaggaggtcggcaccgacattccg
cccgccgtcctcgaactggccgctcagatcgaggggtttccgcggcacctcggcatccac
tcgggcggcatggtgatctgtgaccggccgatcgccgacgtgtgcccggtggagtgggcg
cgcatggagaaccgcagtgtgctgcagtgggacaaggacgattgcgcggcggtgggtctg
gtgaagttcgacatgctgggcctcggcatgctgtccgcgctgcactacatgatcgacctc
gtggccgagcacaagggcatcgaggtggatctggcgcagctggacctctccgaggaggcc
gtctacgagatgttgcagcgggcggattcggtgggggtgttccaggtggagtcgcgggcc
cagatggccaccctgccgaggctgaaaccgcggaacttctacgacctggtggtggaggtg
gcgctcatccgccccggtccgatccagggcggatcggtgcacccgtacatccgacgccgc
aacaagctcgaaccggtgacctacgaccacccgtccctggagaaggcgttgaagcggacg
ctgggtgtgccgctgttccaggagcagttgatgcagatggcggtcgacgtcgcgggtttc
agcccggccgaggccgaccagctccgccgggccatgggttccaagcggtcgcccgagaag
atggaacggctgagggggcggctctaccagggcatgcgggagatgcacgggatcggcgac
gatgtggccgaccggatctacgagaagctgtacgccttcgcgaatttcggtttccccgaa
agtcattcgcagagtttcgccgccctggtgttctattcgtcgtggttcaagttgcatcac
ccggcggcgttctgcgccggtctgctgcgggcgcagccgatggggttctactcgccgcag
tcgctggtggccgacgcccgcaggcacggggtgcaggtgcacggcgcggacatcaatgcg
agtctcgcccacgccaccgtcgaggcgggcgggacggaggtgcgtctcgggctcggggag
gtgcggcacatcgggaccgcgctggccgagcggatcgtcgaatcccgcggcgacggaggg
ccgtacacgtcgttcctcgacctcaccggccgggtggaactgagcacggcgcaagccgaa
tcgctggccaccgcaggtgctctcgacagtttcgggttgtcccgccgggaggcgttgtgg
gcggcgggcgccgcggcgggggagcgccgcgaccggctgccggggatcggggcgtccacc
cgcgcgccgaccctgccggggatgagcgatctcgaactggccgcggcggacgtgtgggcc
accggggtgtccccggacacgtaccctacccagttcctgcgcccgcaactcgacgcgctc
ggggtggtcccggcggcgcacctgctcgatgtccccgacggcgaccgggttctggtgggt
ggggcggtgacccaccggcagcgcccggcgacggccgcgggggtcacgttcatcaacctc
gaggacgagaccgggatggtcaacgtggtgtgttcggtggggttgtgggcgaagtaccgc
aagctcgccaacacggcgcccgcactgctggtccgcggcaaggtgcagaacgcggagggg
gcggtgacggtggtggcggatcggctgcagctgatggatttgcgggtgtccgccaaatcc
agggacttcagatga

DBGET integrated database retrieval system