KEGG   Rhodococcus opacus PD630: Pd630_LPD02889Help
Entry
Pd630_LPD02889    CDS       T03071                                 

Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00020  Citrate cycle (TCA cycle)
roa00480  Glutathione metabolism
roa01100  Metabolic pathways
roa01110  Biosynthesis of secondary metabolites
roa01120  Microbial metabolism in diverse environments
roa01130  Biosynthesis of antibiotics
roa01200  Carbon metabolism
roa01210  2-Oxocarboxylic acid metabolism
roa01230  Biosynthesis of amino acids
Module
roa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
roa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pd630_LPD02889
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Pd630_LPD02889
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Pd630_LPD02889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AHK30112
UniProt: W8GWR4
LinkDB All DBs
Position
3094782..3096005
Genome map
AA seq 407 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIHPYLDVNLEYYDLGIEYRDETDDQVTVDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVPGPGKVMITYTPEDGSEPIEHELVNFPEGGGVVQ
GQYNFTKSIEDFARASLNYGLQQNYPVYLSTKNTILKAYDGAFKDIFQHVYETEFKPEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
KTCEAEAAHGTVTRHFRQHQQGKPTSTNPIASIFAWTRGLEHRGKLDNTPDVIGFAQELE
DVVIKTVEGGQMTKDLAMLVGGDQGYLTTEEFLGALDINLQKAIAEQ
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaatcaaggttgagggcaccgtcgtcgaactcgacggcgacgagatgacacgc
attatctggcagttcatcaaagacaaactgatccatccttacctcgatgtgaacctcgag
tactacgacctcggcatcgagtaccgggacgagaccgacgaccaggtgaccgtcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgaccatcaccccggacgag
gcgcgcgtcgaggagttcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacatcctcggtgggacgatcttccgcgcgccgatcatcatctccaacgttccgcgactg
gttccgggctggaccaagccgatcatcatcggccgtcacgccttcggtgaccagtaccgc
gccaccgacttcaaggtccccggccccggcaaggtgatgatcacctacacgcccgaggac
ggcagcgagccgatcgagcacgagctggtgaacttccccgagggcggcggcgtcgtccag
ggtcagtacaacttcaccaagtccatcgaggacttcgcgcgcgcctcgctcaactacggc
ctgcagcagaactacccggtgtacctgtcgaccaagaacaccatcctcaaggcgtacgac
ggcgcattcaaggacatcttccagcacgtctacgagaccgagttcaagccggagttcgac
gcggccggactcacctacgagcaccgcctcatcgacgacatggtcgcgtcggcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtccagtccgacacc
gtcgcgcagggcttcggatcgctcggcctcatgacttccgtgctgctgaccccggacgga
aagacgtgtgaggccgaggccgcgcacggcaccgtgacgcgtcacttccgtcagcaccag
cagggcaagccgacgtccaccaaccccatcgcgtcgatcttcgcgtggacccgtggactc
gagcaccgcggcaagctggacaacacccccgacgtcatcggcttcgcccaggagctcgaa
gacgtggtcatcaagaccgtcgagggtggccagatgacgaaggacctcgcgatgctggtc
ggcggcgaccagggctacctgaccaccgaggagttcctcggtgcgctggacatcaacctc
cagaaggccatcgccgagcagtag

DBGET integrated database retrieval system