KEGG   Rhodococcus opacus PD630: Pd630_LPD02920Help
Entry
Pd630_LPD02920    CDS       T03071                                 

Definition
(GenBank) Glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00561  Glycerolipid metabolism
roa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Pd630_LPD02920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:roa04147]
    Pd630_LPD02920
Enzymes [BR:roa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pd630_LPD02920
Exosome [BR:roa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pd630_LPD02920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AHK30143
UniProt: W8HAS7
LinkDB All DBs
Position
complement(3123035..3124522)
Genome map
AA seq 495 aa AA seqDB search
MIQYIAAIDQGTTSSRCMIFDHDGAVVSVAQKEHEQFFPRAGWVEHDPTQLWINTREVVA
SALAKADLTKRDIAAIGITNQRETAVVWDRNTGEPVYNAIVWQDTRTDELCTQLGGDDGP
GRYQKRTGLPLSTYFSGPKVRWILDNVDGARAKADAGELCFGTIDSWILWHITEGTHVTD
VTNASRTLLMNLETLDWDPEICADFGIPMSMLPEIRSSSEVYGVGRPHGTLPGVPVAGIL
GDQQAATFGQACLSEGEAKNTYGTGNFLLLNTGTTPVHSKHGLLTTVCYKIGDAPAVYAL
EGSVAVTGSLVQWLRDNLGIIESAKDIEDLAKSVDDNGGAYFVPAFSGLFAPRWRPDARG
AIVGLTRFVNKGHLARAALEATAYQTREVIEAMRADSGVELASLKVDGGMVVNETLMQFQ
SDILAVPVIRPVVNETTALGAAYAAGLAVGFWESEDDIRANWAVDKTWEPAMDEAESTRL
YAEWNKAVERTYDWA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgattcagtacatcgccgcgatagaccagggcaccacctccagccgctgcatgatcttc
gatcacgacggcgccgtggtcagcgtcgcccagaaggaacacgagcagttctttccgcgc
gcaggctgggtggagcacgatccgacgcagctgtggatcaacacccgcgaagtggtggcg
tccgcgctcgcgaaggccgatctcaccaaacgcgacatcgccgcgatcggcatcaccaat
cagcgggagacggcggtcgtgtgggaccggaacaccggagaacccgtgtacaacgccatc
gtctggcaggacacgcgcaccgacgaactgtgcacgcaactcggcggcgacgacggcccg
ggccggtaccagaagcgcaccgggctgccgctgtccacgtatttctcggggccgaaggtc
cggtggattctggacaacgtcgacggtgcacgggcgaaggcggacgcgggcgagctctgc
ttcggcacgatcgacagctggattctgtggcacatcacggagggcacccacgtgacggat
gtcaccaacgcctcccgcaccctgttgatgaatctcgagaccctcgactgggatccggag
atctgtgccgatttcggtatcccgatgtcgatgctgcccgagatccgcagctcgtcggag
gtctacggcgtcggacgcccgcacgggacgctgcccggcgtgccggtggccggaatcctc
ggcgaccagcaggccgccacgttcgggcaggcctgcctgtcggagggcgaagcgaagaac
acgtacgggacggggaacttcctgctgctcaacacggggaccacacccgtgcacagcaag
cacggactcctcaccacggtctgttacaagatcggtgacgcgccggcggtctacgccctc
gaggggtcggtggccgtcaccggctcactggtgcagtggctgcgcgacaacctgggaatc
atcgagtccgccaaggacatcgaggatctggccaagtcggtcgacgacaacggcggcgcc
tacttcgtgcccgcgttctccggtttgttcgcaccgcgctggcggcccgacgcccgcggg
gccatcgtcgggctcacccggttcgtgaacaagggccatctcgccagggccgccctggaa
gccaccgcatatcagacccgcgaggtgatcgaggcgatgcgcgccgattcgggcgtcgaa
ctcgcctccctcaaggtggacggcggcatggtcgtcaacgagaccctcatgcagttccag
tcggacattctcgccgtgcccgtcatccgtcccgtcgtcaacgagacgacggcgctgggc
gccgcgtacgccgcggggctggccgtcggcttctgggagagcgaggacgacatccgcgcg
aactgggcagtcgacaagacgtgggaacccgcgatggacgaggccgagtccacccggctc
tacgccgagtggaacaaggcggtcgaacggacctacgactgggcgtga

DBGET integrated database retrieval system