KEGG   Rhodococcus opacus PD630: Pd630_LPD02927
Entry
Pd630_LPD02927    CDS       T03071                                 

Definition
(GenBank) putative ATP-dependent helicase lhr
  KO
K03724  ATP-dependent helicase Lhr and Lhr-like helicase [EC:3.6.4.-]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD02927
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Pd630_LPD02927
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    Pd630_LPD02927
SSDB
Motif
Pfam: DEAD_assoc DEAD Helicase_C HTH_42 ResIII AAA_22
Other DBs
NCBI-ProteinID: AHK30150
LinkDB
Position
complement(3130098..3134606)
AA seq 1502 aa
MSDVLGRFSAATREWFGGAFPAPTAAQLGAWESIASRAHTLVVAPTGSGKTLSAFLWSLD
QLAATDGKDRKTRVLYISPLKALGVDVERNLRAPLVGITQTAKRLGLTPPEISVGVRSGD
TPAGDRRALIKNPPDILITTPESLFLMLTSAARETLTQVDTVIVDEVHAVAGTKRGAHLA
LSLERLDQLLATPAQRIGLSATVRPHEEVGRFLSGSAPIRIVAPPSPKTFDLTVQVPVED
MTELGLAEPAEGSASATPQAGSIWPHVEEQIVDLVLAHRSSIVFANSRRLAERLTARLNE
IYAERAGTAVDKNPKPASQIGTPSEVNFGADPLLARAHHGSVSKDQRALIEDDLKSGRLR
CVVATSSLELGIDMGAVDLVIQVEAPPSVANGLQRVGRAGHQVGEISRGVVFPKHRTDLV
HCAVTVERMVTGKIEALAVPANPLDILAQHTVAATALEPLDVDDWFETVRRSGSFATLPR
SAFESTLDLLAGLYPSDEFAELRPRLVWDREANTLTGRPGAQRLAVTSGGAIPDRGLFTV
YMVGEKASRVGELDEEMVYESRVGDVFALGATSWRIEEITFDRVLVSPAYGQPGRLPFWH
GDGLGRPAELGEALGQFLREISLGHETEVQERCRTGGLDENATNNLVQLVAEQKTATGQV
PTDRTLVVERFRDELGDWRLILHSPYGQRVHAPWALAVSARLSERYGLDSNATASDDGII
VRLPDTEDTPPGADLFVFDTDEIEDIVTEQVGGSALFASRFRECAARALLLPRRTPGKRA
PLWQQRQRSAQLLDVARRYPTFPILLETVRECLQDVYDLPALKDLLRRLARRQIRIVEVE
TQSPSPFAGALLFNYVGEFMYEGDSPLAERRAAALSLDSTLLAELLGRVELRELLDADVI
AHAELELQRLLPDRKAKDLEGVADLLRLLGPLTSDEVAARSTSDPTPWLDELVRAKRALA
VSFAGHEWWTAIEDAARLRDGLGVPLPIGVPAAFIEPVDDPLADLISRYARTHGPFTITD
AATRFGLGSAVARDVLQRLAQGKRVVEGEFRPGATGSEWCDAEVLRRLRRRSLAAARQEV
EPVSTATLGRFLPGWQHVGGTLRGIDGVATVVEQLAGVPVPASALESLILPSRVADYSPA
MLDELTSTGEVLWSGAGSISGKDGWVCLHPADTAPLTLTTPAESDLSDVQRQVLDTLSGG
GAYFFRQLADTLEMSDDTALATALWDLVWLGHIGNDTLAPVRALLSDTSRTTTSHRSPRR
PPRARAYRSLTVPVRTAPPTVGGRWSILPAAESDATLRASATAELLLERYGVVTRGSVMT
ENVPGGFALMYKVLGTFEDNGRCRRGHFVESLGGAQFSTPPVVDRLRSYADSLEGRHTTL
PAVTLAASDPANPYGAALPWPKRGDDAPAHRPGRKAGGLVVLVEGDLILFVERGGRTILT
FTDDPGVLRTAAVTLAGVVKRGGIDKIVVEKVDGDTIHGSDFAPILTEAGFSPTPRGFRL
RA
NT seq 4509 nt   +upstreamnt  +downstreamnt
gtgagcgacgtcctgggcaggttctccgctgccacccgcgagtggttcggcggcgccttc
ccggcgccgacggccgcgcagctcggtgcgtgggagtcgatcgccagccgcgcgcacacg
ctcgtcgtggccccgaccggttcgggcaagacgttgtccgctttcctgtggtccctcgac
caactcgccgccaccgacgggaaggaccgcaagaccagggtcctctacatctccccgctc
aaggccctgggtgtcgacgtcgaacgcaatctgcgcgccccgctcgtcgggatcacgcag
acggccaagcggctcgggctcacgccgccggagatctcggtgggggtccgctccggcgac
acaccggcaggcgaccggcgcgccctgatcaagaatccgcccgacatcctcatcaccacc
cccgagtcgctgttcctcatgctcacgtccgccgcgcgcgagacgctgacccaggtcgac
accgtcatcgtcgacgaggtgcacgcggtggccggcaccaagcgcggcgcccacctggcc
ctgtcgctcgagcgtctcgaccagcttctcgcgaccccggcgcagcgcatcgggctgtcg
gcgacggtgcgcccgcacgaggaggtgggccggttcctgtccggttcggcgcccatccgg
atcgtcgcaccgccgtcgccgaagacgttcgacctcaccgtgcaggtaccggtcgaggac
atgaccgaactcggcctcgccgaacccgccgagggttcggcgtcggcgaccccgcaggcg
gggtcgatctggccgcacgtcgaggaacagatcgtcgacctcgtcctggcgcaccggtcg
tccatcgtgttcgccaactcgcggcgcctcgccgagcgcctgacggctcggctcaacgag
atctacgccgaacgcgccgggaccgccgtcgacaagaacccgaaaccggcatcgcagatc
ggcacgccgtccgaggtcaatttcggcgcggaccccctgctcgcgcgcgcccaccacggg
tcggtcagcaaggaccagcgggccctgatcgaggacgacctgaagtcggggcgactgcgg
tgcgtggtcgcgacgagcagcctcgaactcggaatcgacatgggcgcggtcgatctggtg
atccaggtcgaggcaccaccgtcggtggcgaacggtctgcagcgggtcggccgcgccgga
caccaggtcggggagatctcccggggtgtcgtgttcccgaagcaccgcaccgatctcgtg
cactgcgccgtcaccgtcgagcgcatggtcaccgggaagatcgaggcgctcgccgtcccc
gccaatccgctcgacatcctcgcccagcacacggtggcggccaccgcgctcgagccgctc
gacgtggacgactggttcgagacggtccggcgcagcggttccttcgcgacgctgccgcgc
tcggcgttcgagtccaccctcgatctgctcgcgggcctctacccgtccgacgagttcgcc
gagctcaggccccgcctcgtctgggaccgcgaggccaacacgctcacgggacgccccggc
gcgcagcggctggcggtcacctcgggaggagccatccccgaccgcggtctgttcacggtc
tacatggtcggcgagaaggcgtcccgcgtcggcgaactcgacgaggagatggtgtacgaa
tcgcgggtcggcgacgtcttcgcgctcggggccaccagctggcggatcgaggagatcacg
ttcgaccgggtgctggtcagccccgcctacgggcagccggggcggctgccgttctggcac
ggtgacggtctgggccggccggcggaactgggcgaggcgctggggcagttcctgcgggag
atctcgctcgggcacgagaccgaggtgcaggaacgctgccgcaccggcgggctcgacgag
aacgccacgaacaatctcgttcagctcgtcgccgagcagaagaccgccaccgggcaggtc
cccaccgaccgcaccctggtggtcgaacgattccgtgacgagctcggcgactggcgactg
atcctgcattcgccgtacggccagcgtgttcacgcaccgtgggcgctggccgtgagtgca
cggctgagcgagcggtacggcctcgactcgaacgcgacggcctccgacgacggcatcatc
gtgcgcctccccgacaccgaggacaccccgcccggcgccgacctcttcgtcttcgacacc
gacgagatcgaggacatcgtcaccgaacaggtcggcggttcggcgctgttcgcgtcccgg
ttccgtgagtgcgcggcccgggcgctgctgcttccgcgccgcacgcccgggaaacgcgca
ccgctctggcagcagcggcagcggtccgcccagctgctcgacgtggcccgccggtatccg
acgttcccgatcctgctcgagaccgtccgcgagtgcctgcaggacgtgtacgacctaccg
gccctgaaggacctgctccgcaggctcgcgcgtcgccagatccgcatcgtcgaggtggaa
acgcagtcgccgtcgccgttcgccggcgccctgctgttcaactacgtcggcgagttcatg
tacgagggcgacagcccgctcgccgaacgccgggcggcggcgctgtccctggactcgacg
ctgctggcggaactgctcggcagggtggaactgcgcgaactgctcgacgccgatgtcatc
gcccacgccgaactcgaactccagcgcctgcttcccgaccgcaaggcgaaggatctcgaa
ggcgtcgccgacctgctgcgcctcctgggtccgctcacctccgacgaggtcgccgcacgg
tcgaccagcgatcccactccctggctcgacgaactcgtccgggcgaagcgggcgctcgcc
gtctccttcgcgggtcacgaatggtggacggccatcgaggatgcggcccgcctgcgcgac
gggctcggggtgccgctacccatcggtgttcccgccgcgttcatcgaacccgtcgacgat
ccgctggccgacctgatcagccggtacgcccgcacccacggcccgttcacgatcaccgac
gccgccacccgtttcgggctcggttccgcggtggcccgtgacgtgctgcagcgacttgcg
cagggaaagcgggtggtcgagggcgagttccgccccggcgcgaccgggagcgaatggtgc
gacgccgaggttctccgccgactccgcaggcgctcgctggccgcggcgcggcaagaggtc
gaaccggtcagcaccgcgacgctcggccgcttcctcccgggctggcagcacgtggggggc
acactgcgcggcatcgacggcgtcgcgaccgtggtggaacagcttgccggcgtcccggtg
cccgcctcggcactcgagtcgctgatcctgccgtcccgggtggccgactactcccccgcc
atgctcgacgaactcacctccaccggcgaggtgctgtggtcgggcgcgggcagcatctcc
ggcaaggacgggtgggtgtgcctccaccccgccgacaccgcaccgctcacgctgaccacg
cccgcggaatcggacctgtccgatgtccagcgccaggtgctcgacacgctgtccggcggc
ggcgcgtacttcttccggcaactcgcggacaccctcgagatgtccgacgacaccgcgctg
gccaccgcattgtgggatctggtgtggctgggccacatcggcaacgacacactcgccccg
gtccgcgccctgctgtcggacacgtccaggaccaccacgagccaccggtcgccgcgacga
cccccacgtgcccgcgcgtaccgcagcctgacggtcccggtgcgcaccgcaccgcccacg
gtcgggggaaggtggtcgatcctccccgccgccgaatccgatgccacgctgcgtgccagc
gccacggccgaactgctcctggagcggtacggggtggtgacgcgcgggtccgtgatgacc
gagaacgttcccggcggattcgcgctgatgtacaaggtgctgggcacgttcgaggacaac
ggccgctgccggcgaggccatttcgtcgagtcgctcggcggtgcacagttctccaccccg
cccgtggtggatcgactccggagctacgccgactcgctcgagggcaggcacaccaccctg
cccgctgtgactctcgccgccagcgatcccgccaacccgtacggtgcggccctcccctgg
ccgaagcgcggcgacgacgcgcccgcgcaccggccgggacgcaaggccggcggcctggtg
gtgctcgtggagggtgacctgatcctgttcgtcgaacgcggcgggcgcacgatcctcacc
ttcaccgacgaccccggcgtgctccgcaccgcggcggtcacgctcgccggtgtggtcaag
cgcggcgggatcgacaagatcgtggtcgagaaggtcgacggcgacaccatccacggcagc
gacttcgcgccgatcctgaccgaggccggtttctcgcccaccccccgcggattccggttg
cgagcctga

DBGET integrated database retrieval system