KEGG   Rhodococcus opacus PD630: Pd630_LPD03048
Entry
Pd630_LPD03048    CDS       T03071                                 

Definition
(GenBank) putative DNA helicase II
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03420  Nucleotide excision repair
roa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    Pd630_LPD03048
   03430 Mismatch repair
    Pd630_LPD03048
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03048
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD03048
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD03048
   MMR (mismatch excision repair)
    Other MMR factors
     Pd630_LPD03048
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 HRDC UvrD_C_2 AAA_30
Other DBs
NCBI-ProteinID: AHK30271
LinkDB
Position
3247058..3249196
AA seq 712 aa
MMDAMSAAGAAEVTSTGLDPEQSAAVLAPRGPVCVLAGAGTGKTRTITRRIAHLVASGHV
AAGQVLAVTFTARAAGEMRGRLRSLGIGDGGAQVQARTFHAAALRQLRYFWPQVIGDTEW
RLLDRKFAVVSSAAGRVGLSTSTESVRDLASEIEWAKASLIAPEDYPRAVAKLRREAPVD
AAKVAEVYHGYEQLKARGQDGMLLDFDDLLLHTAAALEEHSAVAEEFRDRYRCFVVDEYQ
DVTPLQQRVLDAWLGERDDLTVVGDANQTIYSFTGATPNYLLDFSRRFPEATVVRLERDY
RSTPEVVSMANRVIGAARGRIAGTRLQLIGQRDSGPEPSFVEFDDEPAEAAGVARTIKRL
IASGTPAAEIAVLYRINAQSEVHEQALTKLDIPYQVRGGEGFFTRTEVRQAVAALRQAAG
RDDLPDAVGADLVTLVRAVLAPLGLTDAEPAGAQARERWSSLSALVALTEEQLTQDPELT
LDALLRELSLRAEARHPPVVQGVTLASLHAAKGLEWDAVFLVGLTDGTLPIQHVLGDSNS
APDEAAVEEERRLLYVGVTRAREHLQMSWALSRNEGGRKSRRRSRFLHGLIPEDSPASRI
AAPVKSNKKRPRCRLCGKQLIGTTSTMLGRCEGCPSNVDVELLESLRSWRLEKSRELKVP
AYVVFSDNTLTALAEQRPQDDRGLVAIPGIGAKKLEQFGEDVLGVIKGSGSP
NT seq 2139 nt   +upstreamnt  +downstreamnt
atgatggacgccatgtcagcagccggcgcagcagaggtgacgagtaccggtctcgatccc
gaacagtccgcagcggtactcgctccccggggtccggtgtgtgtgctggcgggggccgga
acagggaagacccggaccatcacccggcgtatcgcgcacctcgtggccagtgggcacgtc
gccgcggggcaggtgctggcggtgacgttcacggctcgcgcggcaggcgagatgcgtggc
cggctgcgcagcctggggatcggcgacgggggagcgcaggttcaggcgcgcacgttccac
gccgccgcgctgcggcagctgaggtacttctggccgcaggtgatcggcgacacggagtgg
cggctgctggaccgcaagttcgcggtcgtgtcgtccgccgccggacgggtcggactgtcc
acaagcacagagagcgtccgcgacctggcgagcgagatcgaatgggccaaggcctcgctg
atcgcgccggaggactacccgcgcgcggtggcgaagttgcgccgggaggcgccggtcgac
gccgcgaaggtcgccgaggtatatcacggctacgagcagctgaaggcccgcggccaggac
gggatgctcctcgatttcgacgatctcctgctccacacggcggcggcgctcgaggagcat
tccgctgtcgccgaggagttccgcgaccggtaccggtgcttcgtcgtggacgagtaccag
gacgtcactccgctgcagcagcgagtcctcgacgcctggctcggggagcgggacgacctc
accgtcgtcggtgacgccaaccagaccatctattcgttcaccggcgccacacccaactac
ctgctcgacttctcgcgccggttcccggaggccaccgtcgtgcgcctcgagcgcgactac
cgttcgacccccgaggtcgtgtcgatggcgaaccgggtgatcggagcggcccgcggcagg
atcgcgggcacccgcctgcagctgatcgggcaacgcgactccgggccggagccgagtttc
gtcgagttcgacgacgagccggccgaggcagccggggtggcgcgcacgatcaagcggctc
atcgcctccggcactccggccgcggagatcgcggtcctgtaccggatcaacgcccagtcc
gaggtacatgagcaggcgctgacgaaactcgacatcccgtaccaggtccggggaggtgag
ggattcttcacccgcaccgaggtgcgtcaggccgtggcggcgctgcgccaggccgctggt
cgtgacgacctgccggatgcggtcggcgccgacctggtcacgctcgtccgcgccgtcctc
gctccgctggggctgaccgacgcggaaccggcgggtgcgcaggctcgcgaacggtggtcg
tcgctgtcggcgctggtcgcgctcaccgaggaacagctgacccaggatccggagttgacc
ctcgacgcgctgttgcgcgaactgagtctgcgggccgaggcgcggcatccacccgtcgtg
cagggtgtgacactcgcatccctgcacgccgccaaggggctcgagtgggacgccgtgttc
ctcgtcgggctcaccgacggaacgctgcccatccagcacgtgctcggcgactccaactcg
gcaccggacgaggcggccgtcgaggaggaacgccggttgctgtacgtcggcgtgacccgc
gcccgggagcacctgcagatgtcgtgggcactgtcccggaacgagggcggccgcaagtcg
cggcgccgttcgcggttcctgcacggactcatccccgaagattcaccggcctcgcggatc
gcggcgcccgtcaagagcaacaagaagcgtccacggtgccggctgtgcggaaaacagctg
atcgggacgacctcgaccatgctcggtcgctgcgaggggtgcccgtccaatgtcgacgtg
gaactgctcgaatcgctgcggtcgtggcggctcgagaagtcgcgggagctgaaggttccg
gcgtacgtggtgttcagcgacaacacgttgacggctctcgccgagcagcggccgcaggac
gatcgcgggctcgtcgcgatccccgggatcggtgcgaagaagctcgagcagttcggcgag
gacgtcctcggtgtgatcaagggaagcggtagtccctga

DBGET integrated database retrieval system