KEGG   Rhodococcus opacus PD630: Pd630_LPD03108
Entry
Pd630_LPD03108    CDS       T03071                                 

Definition
(GenBank) Ribonucleoside-diphosphate reductase subunit beta nrdF2
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00230  Purine metabolism
roa00240  Pyrimidine metabolism
roa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Pd630_LPD03108
   00240 Pyrimidine metabolism
    Pd630_LPD03108
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03108
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Pd630_LPD03108
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Pd630_LPD03108
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-ProteinID: AHK30329
LinkDB
Position
3301994..3302959
AA seq 321 aa
MVKLVSRVSAINWNRVQDEKDAEVWDRLVGNFWLPEKVPVSNDIPSWGTLTPQEKQLTMR
VFTGLTLLDTIQGTVGAVSLIPDAITPHEEAVYTNIAFMESVHAKSYSSIFSTLCSTRDI
DDAFRWSEENPNLQRKAEIVMDYYQGDEPLKRKVASTLLESFLFYSGFYLPMYWSSRAKL
TNTADLIRLIIRDEAVHGYYIGYKYQKGLEQLTEAERDDLKNYTFELLFELYDNEVDYTQ
DLYDEVGLTEDVKKFLRYNANKALMNLGYEGLFPKDETDVNPAILSALSPNADENHDFFS
GSGSSYVIGKAVNTEDEDWDF
NT seq 966 nt   +upstreamnt  +downstreamnt
atggtcaagctggtgagtcgcgtatccgcgatcaactggaaccgcgtccaggacgagaag
gacgccgaggtgtgggaccgtctcgtcggcaacttctggctgcccgaaaaggtgccggtg
tccaacgacatcccgtcgtgggggacgctcacgccgcaggagaagcagctcacgatgcgg
gtgttcacggggctgacgctcctcgacaccattcagggcaccgtgggcgcggtcagcctc
atccccgatgccatcaccccgcacgaagaggcggtgtacaccaacatcgcgttcatggag
tcggtacacgcgaagagctacagctcgatcttctcgacgctgtgctccacccgcgacatc
gacgacgccttccgctggtccgaggagaacccgaacctgcagcgcaaggccgagatcgtc
atggactactaccagggcgacgagccgctcaagcgcaaggtggcatccaccctgctcgag
agcttcctgttctactcgggcttctacctgccgatgtactggtcgtcgcgggcgaagctc
accaacaccgccgacctcatccgcctcatcatccgcgacgaggccgtgcacgggtactac
atcggctacaagtaccagaagggcctcgagcagctcaccgaggccgagcgcgacgacctc
aagaactacacgttcgagttgctcttcgagctctacgacaacgaggtcgactacacccag
gacctctacgacgaggtgggcctcaccgaagacgtcaagaagttcctgcggtacaacgcc
aacaaggcgctgatgaacctcggctacgagggtctgttccccaaggacgagacggacgtc
aacccggcgatcctgtcggcgctctcacccaacgcggacgagaaccacgacttcttctcc
ggctcgggcagctcctacgtcatcggcaaggccgtcaacaccgaagacgaggactgggac
ttctag

DBGET integrated database retrieval system