KEGG   Rhodococcus opacus PD630: Pd630_LPD03134
Entry
Pd630_LPD03134    CDS       T03071                                 

Definition
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03030  DNA replication
roa03410  Base excision repair
roa03420  Nucleotide excision repair
roa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Pd630_LPD03134
   03410 Base excision repair
    Pd630_LPD03134
   03420 Nucleotide excision repair
    Pd630_LPD03134
   03430 Mismatch repair
    Pd630_LPD03134
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD03134
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03134
Enzymes [BR:roa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     Pd630_LPD03134
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     Pd630_LPD03134
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     Pd630_LPD03134
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Pd630_LPD03134
   MMR (mismatch excision repair)
    DNA ligase
     Pd630_LPD03134
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pd630_LPD03134
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 BRCT DNA_ligase_ZBD HHH_5 PTCB-BRCT HHH Auto_anti-p27
Other DBs
NCBI-ProteinID: AHK30355
LinkDB
Position
3331011..3333101
AA seq 696 aa
MSESTEAPTPAPGHVREHWNELAEEVRQHQFRYYVRDAPIISDGEFDVLLGELNDLENQY
PDLRTPDSPTQLVGGGFATDFASADHLERMLSLDNVFATDELRTWISRVEQETGPDLHYL
CEVKIDGVALNLVYENGRLVRAATRGDGRTGEEVTLNARTIDDIPEKLTGTDEYPVPALL
EVRGEVFFRLEDFAALNAALVEEGKAPFANPRNSAAGSLRQKNPAVTARRRLGMICHGLG
RSEGFEPVSQYDAYTALAAWGLPVSTHTARVTGADAVVDRVQYWGEHRHDVEHEIDGLVV
KVDETSLQRRLGSTSRAPRWAIAYKYPPEEATTKLLDIRVNVGRTGRVTPFAYMEPVTVA
GSTVSLATLHNGSEVKRKGVLIGDTVVLRKAGDVIPEVLGPVVDARTGDEYEFVMPTHCP
ECDTPLAPAKEGDADIRCPNQQYCPAQLRERVFHVAGRGAFDIEVLGYEAATSLLEAKAI
GDEGDLFSLTEDDLLKTSLFRTKAGGLSANGRRLLDNLDSAKDKPLWRVLVALSIRHVGP
TAARALAGEFGSLERIRESSVEELAAVDGVGGTIAAAVAEWFGVDWHQQIVEKWSAAGVR
MEDERDESIPRNLEGLSIVVTGSLETFSRDQAKEAILVRGGKAAGSVSKKTAFVVVGESP
GSKHDKAVELGVPVLDEDGFRRLLEGGPDAVADSGV
NT seq 2091 nt   +upstreamnt  +downstreamnt
gtgagtgaatcgaccgaagccccgacaccggcccccggacacgtccgggagcactggaac
gagctggccgaggaagtgcggcagcaccagttccgctattacgtccgcgacgcgcccatc
atctccgacggagagttcgacgtgctgctgggcgagctgaacgacctcgagaaccagtac
cccgacctgcggacgcccgattcgccgacgcaactcgtcggcggcggtttcgccaccgac
ttcgcttccgccgatcatctcgagcggatgctcagcctcgacaacgtcttcgccaccgac
gaactgcgcacctggatcagccgggtggagcaggagaccggccccgacctgcactacctg
tgcgaggtgaagatcgacggagtcgcgctgaacctcgtctacgagaacggccggctcgtc
cgggccgccacgcgcggcgacggccggaccggtgaagaagtcactctgaacgcgcgaacc
atcgacgacatcccggaaaagctcaccggcacagacgaatacccggtccccgcgctcctc
gaggtgcgcggcgaggtgttcttccggctcgaggacttcgcggcactcaacgcggcgctc
gtcgaggaaggcaaggcgccgttcgcgaatccccggaactccgcggccgggtcgctgcgg
cagaagaatccggccgtcaccgcccgcaggcgtctcggaatgatctgccacggactcggc
cgcagcgaaggattcgagccggtctcccagtacgacgcgtacacggcactggcggcgtgg
ggcctgccggtgtcgactcacaccgcccgcgtcacgggcgcggacgccgtcgtggaccgg
gtgcagtactggggcgagcaccggcacgacgtggagcacgagatcgacggtctggtggtc
aaggtcgacgagacgtcgctgcaacgccggctcgggtccacgtcccgggcgccgcgctgg
gcgatcgcctacaaatacccgccggaagaggccaccaccaagctcctcgacatccgggtc
aacgtcggtcgcaccggccgggtcaccccgttcgcctacatggaaccggtcacggtcgcc
ggctccaccgtctcactcgccaccctgcacaacggttccgaggtcaaacgcaagggcgtg
ctcatcggcgacacggtcgtgctgcgcaaggccggcgacgtcattcccgaggtcctcggg
cccgtggtcgacgcccggacgggcgacgagtacgagttcgtgatgcccacccactgcccg
gagtgcgacacgccgctggcccccgccaaggagggggacgcggacattcgctgccccaac
cagcagtactgccccgcgcagctccgggaacgcgtgttccacgtcgcgggccgcggcgcg
ttcgacatcgaggtcctcggctacgaggccgccacgagcctgctcgaggccaaggcgatc
ggcgacgagggagacctgttctcgctcaccgaggacgatctgctcaagacgtcgctcttc
cggaccaaggccggcgggctgtcggccaacggccgccggctgctcgacaatctcgattcc
gccaaggacaagccgctgtggcgggtgctggtcgcgctgtccatccgtcatgtcggtccc
acggcggcgcgtgcgctggccggtgaattcgggtcgctcgagcggatccgggagagctcc
gtcgaggaactcgccgctgtggacggggtcggcggcaccatcgccgcggccgtcgccgag
tggttcggcgtcgactggcaccagcagatcgtggagaagtggtccgcggccggggttcgc
atggaagacgaacgcgacgaatcgattccgcgcaacctcgagggactgtcgatcgtcgtc
acgggttcgctcgagacgttctcgcgcgaccaggcgaaggaggcgatcctcgtccgaggc
ggtaaggccgcgggttcggtgtcgaagaagacggcattcgtggtggtcggcgaatcgccg
ggttcgaagcacgacaaggccgtcgaactcggagtgccggtcctcgacgaggacgggttc
cgtcgactgctggagggcggaccggacgcggtcgcggattccggagtgtga

DBGET integrated database retrieval system