KEGG   Rhodococcus opacus PD630: Pd630_LPD03169
Entry
Pd630_LPD03169    CDS       T03071                                 

Definition
(GenBank) DNA-binding protein HU
  KO
K03530  DNA-binding protein HU-beta
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:roa03032]
    Pd630_LPD03169
   03036 Chromosome and associated proteins [BR:roa03036]
    Pd630_LPD03169
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03169
DNA replication proteins [BR:roa03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Pd630_LPD03169
Chromosome and associated proteins [BR:roa03036]
 Prokaryotic type
  Nucleoid associated proteins
   HU (heat unstable protein)
    Pd630_LPD03169
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      Pd630_LPD03169
SSDB
Motif
Pfam: Bac_DNA_binding HC2 HU-CCDC81_euk_2 HU-HIG HU-CCDC81_bac_2
Other DBs
NCBI-ProteinID: AHK30388
LinkDB
Position
3367930..3368532
AA seq 200 aa
MNKAELIDVLTEKLGTDRRTATEAVEHVVDTIVRAVHRGDSVTITGFGVFEQRRRAARVA
RNPRTGETVKVKPTSVPAFRPGAQFKAVIAGGQKLPATGPAVKRGAAAPATKAAAKKAAA
KKTAAKKTAAKKAAPAKTVAAKKTAAKKAPAKTTAAKKTVAKKVAPAKTVAAKKTAAKKA
PAKTAAKKTAAKKAPAKRAK
NT seq 603 nt   +upstreamnt  +downstreamnt
atgaataaggcagagctcatcgatgttctgaccgagaaactgggcacggacaggcgcacg
gcaacggaagctgtcgagcatgtcgtggacacgatcgtccgggcagtgcaccgcggcgac
agcgtgaccatcaccggtttcggtgtcttcgagcagcgtcgtcgcgcggcacgtgtcgca
cgtaacccgcgcacgggtgagaccgtcaaggtcaagccgacgtcggtgccggcgttccgc
ccgggcgctcagttcaaggcggttatcgctggcggccagaagcttccggccaccggtccg
gcagtcaagcgcggtgcagcggcacccgccaccaaggccgccgccaagaaggctgctgcc
aagaagacggctgccaagaagaccgcagccaagaaggcagctccggccaagaccgtggcc
gccaagaagaccgcggccaagaaggctccggccaagaccacggctgccaagaagaccgtg
gcgaagaaggtggctccggccaagaccgtggctgccaagaagactgcggccaagaaggct
ccggccaagactgccgccaagaagaccgcagcaaagaaggctcccgcgaagcgcgccaag
taa

DBGET integrated database retrieval system