KEGG   Rhodococcus opacus PD630: Pd630_LPD03170
Entry
Pd630_LPD03170    CDS       T03071                                 

Definition
(GenBank) putative mutator mutT1 protein
  KO
K23258  8-oxo-(d)GTP phosphatase [EC:3.6.1.69]
Organism
roa  Rhodococcus opacus PD630
Brite
KEGG Orthology (KO) [BR:roa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03170
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.69  8-oxo-(d)GTP phosphatase
     Pd630_LPD03170
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Pd630_LPD03170
SSDB
Motif
Pfam: NUDIX His_Phos_1
Other DBs
NCBI-ProteinID: AHK30389
LinkDB
Position
complement(3368636..3369571)
AA seq 311 aa
MSSSPGKPVKANIFAAGAVLWRKSPGNPDEIEIALIHRPKYEDWSFPKGKLDPGETAVVA
ALREVEEETGIRGRLGRHLGALTYPIPGHRRLKRVEYWAAEARAGEFVSNSEVDEMRWLP
VSEVADQLSYPMDRKMLRRFTAQPPDTATVLLVRHAKAGSRKRYKGDDTTRPLDANGQLQ
AEALVAQLEAFGATDITSADRTRCTQTVEPLARALDTTVRLDPLLSEESYTADPVATRTR
VRKIAALGGVQVICSQGGVIPDLLDWWAEIDGIALPPARNRKASTWVLSLSGGKLIAADH
IDSPLPPTRKD
NT seq 936 nt   +upstreamnt  +downstreamnt
gtgagcagttcacccggcaaaccggtcaaagccaatatcttcgccgcgggcgccgtgctg
tggcgaaaatctcccggcaatcccgacgagatcgagatcgcgctcattcaccggcccaaa
tacgaggactggtcatttcccaagggaaagctcgaccccggcgagaccgccgtggtggcc
gcactgcgtgaggtggaagaagagacgggaattcgcgggcgtctcggccggcatctcggc
gcgttgacgtatccgattccgggccaccgccgattgaaacgagtcgaatactgggctgca
gaagcccgcgccggcgaattcgtctccaacagcgaagtggacgaaatgcggtggcttccc
gtatccgaggtcgccgatcagctgtcgtatcccatggatcgcaagatgctccgtcgattc
acggctcagccacccgacaccgcgaccgtgctactggtccggcacgccaaggctggaagc
cggaaacggtacaagggtgacgacaccacccggcccctggatgcgaacggccaactccag
gccgaagcgctcgtcgcgcagctcgaggcgttcggagccacggacatcacgtcggccgac
cggacgcggtgcacacagacggtcgagccgctggcacgcgcgttggacacgaccgtccgg
ttggatccgctgctgtccgaggagagttacaccgccgacccggtggccactcgcacacgg
gtccgcaagatcgccgctctcggcggagttcaggtgatctgcagtcagggtggcgtcatt
cccgatctgctcgactggtgggcggagatcgacggcatcgcgcttcccccggcgcggaac
cgaaaggcgagcacctgggtgctctcgctgtccggtggcaaactcatcgccgccgaccat
atcgacagtccgctgcctcccacccggaaggactga

DBGET integrated database retrieval system