KEGG   Rhodococcus opacus PD630: Pd630_LPD03186
Entry
Pd630_LPD03186    CDS       T03071                                 

Definition
(GenBank) ATP-dependent DNA helicase recG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD03186
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03186
Enzymes [BR:roa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pd630_LPD03186
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Pd630_LPD03186
SSDB
Motif
Pfam: Helicase_C DEAD ResIII AAA_30 tRNA_anti-codon RecG_wedge SNF2_N AAA_22 DUF3638 ERCC3_RAD25_C
Other DBs
NCBI-ProteinID: AHK30405
LinkDB
Position
3382408..3384666
AA seq 752 aa
MATLSDRLDHLLGKKTADALEEAFDIRTVEDLLRHYPHRYASQGRELAEKDPPEGEHITI
IARVTSAAVVKMKNRPGSMLKVVLSTDTQNVDVTFFSPQKVKHVIKPGVRAMFSGTVKYF
RQKWSLTHPSYLILPEPRAGSEDPVVNVDRIRGAGDLAGIARASQEPGAGVDLSVFDRAL
IPLYPATRDVESWTIMKCVRQILDQLDHVDDPLPETIRAERDLIGLDEALRSVHLPDTRE
DVENAHDRLRFDEATALQLVLARRRHDNAERVAPECPPVPGGIADVFEKMLPFQLTDGQH
AVADEISADLAQPHPMSRLLQGEVGSGKTIVALRAMLQVVDAGYQCALLAPTEVLATQHA
RSLRAMLGSLATAGELGAHEKATRVALLTGSIPVAAKRTALNEAITGDAGIVIGTHALIQ
DNVEFFNLGMVVVDEQHRFGVEQRDRLRSRAREGLSPHLLVMTATPIPRTIAMTVLGDLE
VSTLRQLPKGRSPIKSSVVPASQKPQWVARAWERIREDVAEGRQAYVVCSRIGDGEKGDG
EDAFDEKAPETKSAVEVFEELSGTIMPDLRVGLLHGRLPADEKDAVMRDFTAGDIDVLVC
TTVVEVGVDVPNATIMVIVDADRFGVSQLHQLRGRVGRGKHQGLCILVTKMNPGGPAYER
LSSVASTNDGFELAQLDLATRREGDILGAAQSGTTSTLRLLSLLGHEDVIAAASEFARSV
IADDPRLENHPGLSAMVTSALDADRIEYLEKT
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggccacattgtccgaccggctcgatcatctgctggggaagaagaccgccgacgcgctc
gaggaggcgttcgacatccgcacggtcgaggacctgctgcggcattacccgcaccggtac
gcctcgcagggccgcgagctcgcggagaaggacccgccggagggcgagcacatcacgatc
atcgcccgggtcacgtccgcggccgtcgtgaagatgaagaaccggccgggcagcatgctc
aaggtggtcctgtcgaccgacacccagaacgtggacgtcaccttcttcagcccgcagaag
gtcaagcacgtgatcaagccgggtgtgcgcgcgatgttctcgggaacggtcaagtacttc
cgccagaagtggagcctcacccatccgagctacctcatccttcccgagccgcgtgccggc
agcgaggaccccgtcgtgaacgtcgacaggatccgcggtgccggggatctcgcgggaatc
gcccgggcgtcgcaggaacccggtgcgggggtcgatctgtccgtgttcgaccgggcgctg
atcccgctctatcccgccacgcgggacgtcgagagctggacgatcatgaagtgcgtccgc
cagatcctggaccagctcgatcacgtcgacgacccgctgccggagaccatccgggccgaa
cgcgacctgatcggtctcgacgaagccctccggtcggttcacctgcccgacacccgcgag
gacgtggagaacgcccacgaccgcctgcggttcgacgaggcgacggcgctccagctggtt
ctcgcccgtcgccgtcacgacaatgccgagcgagtcgcgcccgagtgcccgccggtgccc
ggcgggatcgccgacgtgttcgagaagatgcttccgttccagctcaccgacggtcagcac
gcggtcgccgacgagatctcggccgatctggcgcagccacacccgatgagcaggctgctg
cagggtgaggtgggttcgggtaagacgatcgtggccctgcgcgccatgctccaggtggtc
gacgccggttaccagtgcgccctgctcgcgccgaccgaggtcctcgcgacgcagcacgcc
cggtcgttgcgggcgatgctcggctccctcgcgaccgccggggaactcggggcgcacgag
aaggccacacgggtggcgctgctgacggggtcgataccggtcgccgccaaacgcaccgct
ctcaacgaggcgatcaccggcgacgccgggatcgtcatcggcacgcacgccctgatccag
gacaacgtcgaattcttcaatctcgggatggtggtggtcgacgagcagcaccggttcggt
gtcgagcagcgcgaccggctgcggtcgagggcgcgggagggcctgagcccgcatctgctg
gtgatgacggcgacgccgattccccgcaccatcgcgatgacggtgctcggcgatctcgag
gtgtcgacgctgcgccagctgccgaaggggcggtcaccgatcaagagcagtgtggtaccc
gcgtcccagaagccgcagtgggttgcgcgcgcgtgggaacggatccgcgaggacgtggcc
gaggggcggcaggcgtacgtcgtgtgctcgcgcatcggagacggcgagaagggtgacggt
gaggacgcgttcgacgagaaagcgcccgagacgaagtccgccgtcgaggtgttcgaggag
ttgagcggcacgatcatgccggacctgcgggtgggtctgctgcacggccggcttcccgcg
gacgagaaggatgcggtgatgcgcgacttcacggccggcgacatcgacgtcctcgtgtgc
accacggtcgtggaggtcggcgtcgacgtcccgaacgcgacgatcatggtgatcgtcgac
gcggaccgtttcggtgtgagtcagctgcaccagctgcgcggacgcgtcggccgtggcaaa
caccagggcctgtgcattctcgtcacgaagatgaatccgggcggtcccgcctacgagcga
ttgtcgagcgtggcgtcgaccaacgacggtttcgaactggcgcaactcgacctcgccacg
cgccgcgagggcgacattctcggtgcggcgcagtcgggcacgacatccacgttgcggctg
ttgtcgctactcggccacgaggacgtcatcgccgcggcgtccgagttcgcgcgttcggtg
atcgcggacgacccgcgcctcgagaaccatcccggactgtcggcgatggtgacgtcggcg
ctcgacgccgaccgcatcgaatatctggagaaaacgtga

DBGET integrated database retrieval system