KEGG   Rhodococcus opacus PD630: Pd630_LPD03194
Entry
Pd630_LPD03194    CDS       T03071                                 

Definition
(GenBank) Formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Pd630_LPD03194
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03194
Enzymes [BR:roa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Pd630_LPD03194
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Pd630_LPD03194
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Pd630_LPD03194
SSDB
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS FbpA TackOD1 Zn_Tnp_IS1595 DZR Anti-TRAP
Other DBs
NCBI-ProteinID: AHK30413
LinkDB
Position
3391836..3392714
AA seq 292 aa
MPELPEVEVVRRGLERHIVGASIDSVDILHPRAIRRHLPGAADLAGQLTGERIASADRRG
KYLWLVLEPSTVALVVHLGMSGQMLVQPPELPTEKHLRIRARLDSGLDLRFVDQRTFGGW
ALAPLVDVDGSLVPDSVAHIARDPLDPRFDLTATVKVVRGKHTEIKRALLDQTVVSGIGN
IYADEALWRAQIHGNRLTDRLSGPKIREVLTAAQEVMREALTQGGTSFDALYVNVNGESG
YFDRSLSAYGQEDRPCPRCGTAIRREKFMNRSSFSCPKCQPAPRRSPAKSSV
NT seq 879 nt   +upstreamnt  +downstreamnt
gtgcctgaactacccgaagtcgaggtggtccggcgcggactcgaacgccacatcgtgggg
gcgtcgatcgattccgtcgacatcctgcatccgcgggcgatccggcgtcatctgcccggc
gccgccgacctcgccggacagctcaccggcgaacgcatcgcgagcgccgaccgtcgtgga
aagtatctgtggctggtcctcgaacccagcaccgtcgctctcgtggtgcatctgggcatg
agtggtcaaatgctcgtgcagccaccggaattgccgaccgagaagcatctgcgcatccgg
gcccggctcgattccggtctcgacctccggttcgtcgaccagcggacgttcgggggctgg
gcgctggcacctctcgtcgacgtcgacggatcgctcgtgccggactcggtggcgcacatc
gcccgtgatccactggatccgcggttcgacctcacggcgaccgtgaaggtcgtgcgcggc
aagcacaccgagatcaagcgtgcgcttctggaccagaccgtcgtctccggcatcggcaac
atctacgcggacgaggcgctgtggcgcgcccagatccacgggaatcggctcaccgacagg
ctgagtggtcccaagatccgtgaagtgctcacggccgcgcaggaggtcatgcgtgaggcg
ctcacccagggcggcacgtccttcgacgctctctacgtgaacgtcaacggcgagtcgggc
tatttcgaccgttcgctgtccgcctacggtcaggaggatcgcccgtgcccgcggtgcggc
accgcgatccggcgggagaaattcatgaaccgctcgtcgttcagttgcccgaagtgccag
ccggcaccacggagaagcccggcgaaatcgtctgtgtga

DBGET integrated database retrieval system