KEGG   Rhodococcus opacus PD630: Pd630_LPD03313
Entry
Pd630_LPD03313    CDS       T03071                                 

Definition
(GenBank) Uncharacterized protein
  KO
K06881  bifunctional oligoribonuclease and PAP phosphatase NrnA [EC:3.1.3.7 3.1.13.3]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00920  Sulfur metabolism
roa01100  Metabolic pathways
roa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Pd630_LPD03313
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03313
Enzymes [BR:roa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Pd630_LPD03313
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.3  oligonucleotidase
     Pd630_LPD03313
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   Others
    Pd630_LPD03313
SSDB
Motif
Pfam: DHH DHHA1 DUF4350 CDC45
Other DBs
NCBI-ProteinID: AHK30532
LinkDB
Position
3505196..3506197
AA seq 333 aa
MTHTQETSLSDLDRHEVFLPQAVAVLENATSVTVLCHVQPDADTIGSGLALALVLERKGI
PVQVAFAAPDELPESMRELPGTHLLVPADQVRRNVDLLVTVDCGSAGRLGKLADRLAHAG
ETLVIDHHRSNTRFGRMNLIDESAESTTAVVAQMFDLWGVDIDADLAHCLYAGLVTDTGS
FRWVQPGTHTLAERLLATGIDGARIARRLLDTHPFGWLPMLSSVLGSATLVPDAAGGRGL
VYAVIRQAYVGDLRSEEIESVIDIVRTTSEAEVAAVLKEAVDGTWSVSLRSKSDVDVSVV
AGYLGGGGHRFAAGYTAENSADEIVTSLVESLG
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgacccacactcaggagacgtccctgtctgatctcgatcgtcacgaggtgttcctgccg
caggcggtcgctgttctcgagaacgcgacgtcggtgacggttctgtgtcacgtccaaccc
gatgccgacacgatcggcagtggactcgccctggcgttggtgctcgagcgcaagggaatt
ccggtgcaggtcgcgttcgccgcgcccgacgaactgccggagtcgatgcgtgaactgccg
ggcacccacctgctggtgcctgcggatcaggtgcgccgcaacgtcgatctgctcgtgacc
gtcgactgcggcagcgccgggcggctcgggaagctcgccgaccggctcgcgcacgcgggg
gagaccctcgtcatcgaccaccaccggtccaacacccgcttcggtcgcatgaacctgatc
gacgagtccgcggagtcgacgaccgcggtcgtggcgcagatgttcgacctgtggggtgtg
gatatcgacgccgacctcgcacactgcctgtacgcgggactcgtgaccgacaccggttcg
ttccggtgggtgcagcccggcacccacacgctcgccgagaggttgctcgccaccgggatc
gacggtgcccgcatcgcgcggcgcctgctcgacacccacccgttcggctggttgcccatg
ctgtcctcggtgctcgggtcggcgaccctcgtccccgacgcagcgggagggcgtggactg
gtctacgccgtcatccggcaggcctacgtcggagacctccgctcggaggagatcgaaagc
gtcatcgacatcgtccggacgacgtccgaggccgaggtcgccgcagtcctcaaggaggcc
gtggacggcacctggtcggtatcgctgcggtcgaagtccgacgtggacgtgtccgtcgtc
gccgggtatctcggcggaggcggtcatcggttcgccgccggctacacggccgagaactct
gcggacgagatcgtgacctcgctcgtcgaatcgctcggctga

DBGET integrated database retrieval system