KEGG   Rhodococcus opacus PD630: Pd630_LPD03385
Entry
Pd630_LPD03385    CDS       T03071                                 

Definition
(GenBank) Protein RecA
  KO
K03553  recombination protein RecA
Organism
roa  Rhodococcus opacus PD630
Pathway
roa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:roa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Pd630_LPD03385
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:roa03400]
    Pd630_LPD03385
DNA repair and recombination proteins [BR:roa03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pd630_LPD03385
    RecFOR pathway proteins
     Pd630_LPD03385
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Pd630_LPD03385
SSDB
Motif
Pfam: RecA Rad51 ATPase AAA_24 ATPase_2 AAA_25 CobU AAA_16 AAA
Other DBs
NCBI-ProteinID: AHK30604
LinkDB
Position
3581371..3582414
AA seq 347 aa
MAPQAHDRDKALDLALAQIDKNFGKGSVMRLGEGVRQPIAVIPTGSIALDVALGIGGLPR
GRVVEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPDYAQKLGVDTDALLVSQ
PDTGEQALEIADMLIRSGALDILVVDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKM
TGALSNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYSSVRLDVRRIETLKDGTDAV
GNRTRVKVVKNKVAPPFKQAEFDILYGLGISKEGSLIDMGVEHGFIRKSGSWYTYEGDQL
GQGKENARKFLLENTDIRDEIEKKIKEKLGIGADVTAATDDAAPVEF
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcaccacaggcacacgatcgagacaaggcgctcgacctcgcgctggcgcagatcgac
aagaacttcggcaagggctcggtgatgcgcctgggcgaaggtgtccgtcagcccatcgcc
gtcatcccgaccggctccatcgcgctggacgtcgccctcggcatcggcgggctgccccgc
ggccgtgtcgtcgagatctacggcccggagtcctcgggtaagaccaccgtggccctgcac
gcggtcgccaacgcccaggcggcgggcggcatcgccgcgttcatcgacgccgagcacgcg
ctcgaccccgactacgcccagaagctcggcgtcgacaccgacgcgctgctggtgtcacag
cccgacaccggtgagcaggcgctggagatcgcagacatgctgatccgctccggcgccctc
gacatcctcgtggtcgactccgtggccgccctggtcccgcgcgccgagatcgagggtgag
atgggcgacagccacgtgggtctgcaggcgcgtctgatgagccaggcgctccgtaagatg
accggtgcgctcagcaattccggcaccaccgcgatcttcatcaaccagctgcgcgagaag
atcggcgtcatgttcggttcccccgaaaccaccaccggtggtaaggcattgaagttctac
tcgtcggtgcgcctcgacgtgcggcggatcgagaccctgaaggacggcaccgacgcggtg
ggtaaccgtacccgcgtcaaggtggtcaagaacaaggtcgcaccgccattcaagcaggcc
gagttcgacattctctacggcctgggaatcagcaaggaaggctcgctgatcgacatgggt
gtcgagcacgggttcatccgcaagtcgggctcctggtacacctacgaaggcgaccagctg
ggacagggcaaggagaacgcccgcaagttcctgttggagaacaccgacatccgggacgag
atcgagaagaagatcaaggaaaagctcggaatcggcgcggacgtcactgctgccacggat
gacgccgccccggtcgaattctaa

DBGET integrated database retrieval system